Aldehyde dehydrogenase 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90192

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aldehyde dehydrogenase 5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunocytochemistry/ Immunofluorescence: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunocytochemistry/Immunofluorescence: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Aldehyde dehydrogenase 5 Antibody - BSA Free Immunohistochemistry: Aldehyde dehydrogenase 5 Antibody - BSA Free [NBP1-90192]

Immunohistochemistry: Aldehyde dehydrogenase 5 Antibody - BSA Free [NBP1-90192]

Analysis in human liver and tonsil tissues using NBP1-90192 antibody. Corresponding ALDH1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human tonsil shows weak granular cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192]

Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Aldehyde dehydrogenase 5 Antibody - BSA Free Western Blot: Aldehyde dehydrogenase 5 Antibody - BSA Free [NBP1-90192]

Western Blot: Aldehyde dehydrogenase 5 Antibody - BSA Free [NBP1-90192]

Analysis in human cell line RH-30.

Applications for Aldehyde dehydrogenase 5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aldehyde dehydrogenase 5

Aldehyde dehydrogenase 5 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. [provided by RefSeq]

Alternate Names

aldehyde dehydrogenase 1 family, member B1, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH class 2, ALDH5aldehyde dehydrogenase X, mitochondrial, ALDHXacetaldehyde dehydrogenase 5, EC 1.2.1, EC 1.2.1.3, MGC2230, mitochondrial aldehyde dehydrogenase X

Gene Symbol

ALDH1B1

Additional Aldehyde dehydrogenase 5 Products

Product Documents for Aldehyde dehydrogenase 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aldehyde dehydrogenase 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aldehyde dehydrogenase 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aldehyde dehydrogenase 5 Antibody - BSA Free and earn rewards!

Have you used Aldehyde dehydrogenase 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...