ALDH1L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55574

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINP

Reactivity Notes

Mouse 83%, Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ALDH1L1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Analysis in human liver and lymph node tissues using NBP2-55574 antibody. Corresponding ALDH1L1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-ALDH1L1 antibody NBP2-55574 (A) shows similar protein distribution across tissues to independent antibody NBP1-89414 (B).
Immunocytochemistry/ Immunofluorescence: ALDH1L1 Antibody [NBP2-55574]

Immunocytochemistry/ Immunofluorescence: ALDH1L1 Antibody [NBP2-55574]

Immunocytochemistry/Immunofluorescence: ALDH1L1 Antibody [NBP2-55574] - Staining of human cell line Hep G2 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.
Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574]

Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human lymph node shows no positivity in germinal center cells as expected.

Applications for ALDH1L1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:5000 -1:10000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALDH1L1

ALDH1L1 is encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.

Alternate Names

10-formyltetrahydrofolate dehydrogenase, aldehyde dehydrogenase 1 family, member L1, aldehyde dehydrogenase family 1 member L1, Cytosolic 10-formyltetrahydrofolate dehydrogenase, DKFZp781N0997, EC 1.5.1.6,10-FTHFDH, FDH, formyltetrahydrofolate dehydrogenase, FTHFD10-fTHF

Gene Symbol

ALDH1L1

Additional ALDH1L1 Products

Product Documents for ALDH1L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALDH1L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALDH1L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALDH1L1 Antibody - BSA Free and earn rewards!

Have you used ALDH1L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...