Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

Novus Biologicals | Catalog # H00057016-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1A6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE

Reactivity Notes

Human. Other species not tested.

Specificity

AKR1B10 - aldo-keto reductase family 1, member B10 (aldose reductase)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Novus Biologicals Mouse Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free (H00057016-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-Aldo-keto Reductase 1B10/AKR1B10 Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - AKR1B10 monoclonal antibody (M01), clone 1A6 Analysis of AKR1B10 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1B10 transfected lysate(36 KDa).Lane 2: Non-transfected lysate.
ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01]

ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03ng/ml as a capture antibody.

Applications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Aldo-keto Reductase 1B10/AKR1B10

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Long Name

Aldo-keto Reductase Family 1, Member B10 [Aldose Reductase]

Alternate Names

AKR1B10, AKR1B11, AKR1B12, AldoketoReductase 1B10, ARL1, HIS, HSI

Entrez Gene IDs

57016 (Human)

Gene Symbol

AKR1B10

OMIM

604707 (Human)

Additional Aldo-keto Reductase 1B10/AKR1B10 Products

Product Documents for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

Customer Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free and earn rewards!

Have you used Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies