Aldolase C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90954

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aldolase C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI

Marker

pan-Astrocyte Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aldolase C Antibody - BSA Free

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex and pancreas tissues. Corresponding ALDOC RNA-seq data are presented for the same tissues.
Western Blot: Aldolase C Antibody [NBP1-90954]

Western Blot: Aldolase C Antibody [NBP1-90954]

Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Aldolase C Antibody [NBP1-90954]

Immunocytochemistry/ Immunofluorescence: Aldolase C Antibody [NBP1-90954]

Immunocytochemistry/Immunofluorescence: Aldolase C Antibody [NBP1-90954] - Staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human cerebral cortex shows strong cytoplasmic positivity in a subset of glial cells.
Western Blot: Aldolase C Antibody [NBP1-90954]

Western Blot: Aldolase C Antibody [NBP1-90954]

Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954]

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Applications for Aldolase C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aldolase C

The Aldolase C gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in thehippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversiblealdol cleavage of fructo

Alternate Names

ALDC, aldolase 3, aldolase C, fructose-bisphosphate, Brain-type aldolase, EC 4.1.2.13, fructoaldolase C, fructose-1,6-biphosphate triosephosphate lyase, fructose-bisphosphate aldolase C

Gene Symbol

ALDOC

Additional Aldolase C Products

Product Documents for Aldolase C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aldolase C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Aldolase C Antibody - BSA Free

Customer Reviews for Aldolase C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aldolase C Antibody - BSA Free and earn rewards!

Have you used Aldolase C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies