Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free

Novus Biologicals | Catalog # H00000081-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4D10

Format

Azide and BSA Free
View all Alpha Actinin 4 Primary Antibodies »

Product Specifications

Immunogen

ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Specificity

ACTN4 - actinin, alpha 4

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody (M01), clone 4D10.Lane 1: ACTN4 transfected lysate(104.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Immunocytochemistry/ Immunofluorescence: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Immunocytochemistry/Immunofluorescence: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on HeLa cell. Antibody concentration 20 ug/ml.
Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human lung adenocarcinoma. Antibody concentration 3 ug/ml.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in PC-12.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10 Analysis of ACTN4 expression in Hela S3 NE.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in Raw 264.7.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in MCF-7.
Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Western Blot: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - ACTN4 monoclonal antibody (M01), clone 4D10. Analysis of ACTN4 expression in NIH/3T3.
Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

Immunohistochemistry-Paraffin: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Analysis of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
ELISA: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

ELISA: Alpha Actinin 4 Antibody (4D10) [H00000081-M01]

ELISA: Alpha Actinin 4 Antibody (4D10) [H00000081-M01] - Detection limit for recombinant GST tagged ACTN4 is approximately 0.1ng/ml as a capture antibody.

Applications for Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Alpha Actinin 4

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis.

Alternate Names

actinin alpha4 isoform, actinin, alpha 4, ACTININ-4, alpha-actinin-4, DKFZp686K23158, F-actin cross-linking protein, focal segmental glomerulosclerosis 1, FSGS, FSGS1, Non-muscle alpha-actinin 4

Entrez Gene IDs

81 (Human)

Gene Symbol

ACTN4

OMIM

603278 (Human)

UniProt

NP_004915 (Human)

Additional Alpha Actinin 4 Products

Product Documents for Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free

Customer Reviews for Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free and earn rewards!

Have you used Alpha Actinin 4 Antibody (4D10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies