alpha COP I Antibody (3W6Y6)

Novus Biologicals | Catalog # NBP3-15839

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3W6Y6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human alpha COP I (P53621). MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha COP I Antibody (3W6Y6)

Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839]

Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839]

Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Western blot analysis of extracts of various cell lines, using alpha COP I Rabbit mAb (NBP3-15839) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839]

Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839]

Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Western blot analysis of extracts of Rat brain, using alpha COP I Rabbit mAb (NBP3-15839) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
alpha COP I Antibody (3W6Y6)

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] -

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded human thyroid cancer tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha COP I Antibody (3W6Y6)

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] -

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded human colon tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha COP I Antibody (3W6Y6)

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] -

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded human colon carcinoma tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha COP I Antibody (3W6Y6)

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] -

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded mouse brain tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha COP I Antibody (3W6Y6)

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] -

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded rat colon tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha COP I Antibody (3W6Y6)

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] -

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded mouse testis tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for alpha COP I Antibody (3W6Y6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha COP I

Coatomer proteins are involved in regulating transport between the endoplasmic reticulum (ER) and the Golgi complex and in intra-Golgi transport. There exist two coatomer-protein mechanisms (COP I and COP II) and although they have mechanistic parallels, they are molecularly distinct. The COP I coat is comprised of seven subunits (alpha-, beta-, beta'-, gamma-, delta-, epsilon-, and zeta-COP) in a complex called coatomer. Assembly of the coatomer (COP I) onto non-clathrin coated vesicles is regulated by ADP-ribosylation factor (ARF). Vesicle formation, budding, fusion, and disassembly is dependent on GDP-GTP exchange, COP I, and ARF. COP I has been shown to facilitate retrograde intracellular transport from the ER to the Golgi complex. By contrast, COPII facilitates anterograde transport between these subcellular organelles. COP II has been shown to be independently and selectively recruited to the ER relative to COP I subunits.

Alternate Names

alpha coat protein, Alpha-coat protein, Alpha-COP, coatomer protein complex, subunit alpha, coatomer subunit alpha, FLJ26320, HEPCOP, HEP-COPalpha-COP, xenin

Gene Symbol

COPA

Additional alpha COP I Products

Product Documents for alpha COP I Antibody (3W6Y6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha COP I Antibody (3W6Y6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha COP I Antibody (3W6Y6)

There are currently no reviews for this product. Be the first to review alpha COP I Antibody (3W6Y6) and earn rewards!

Have you used alpha COP I Antibody (3W6Y6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...