Alpha Fodrin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53093

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Alpha Fodrin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SPTAN1(spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)) The peptide sequence was selected from the N terminal of SPTAN1. Peptide sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

272 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Alpha Fodrin Antibody - BSA Free

Western Blot: Alpha Fodrin Antibody [NBP1-53093]

Western Blot: Alpha Fodrin Antibody [NBP1-53093]

Western Blot: Alpha Fodrin Antibody [NBP1-53093] - NT-2 cell line, mouse brain, and rat brain, Antibody Titration: 0.2-1 ug/ml
Immunocytochemistry/ Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093]

Immunocytochemistry/ Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093]

Immunocytochemistry/Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in methanol-aceton fixed Caco-2 cells using anti-Alpha Fodrin antibody. Image from verified customer review.
Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093]

Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093]

Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093] - Immunohistochemistry with NT-2 cell line, mouse brain, and rat brain tissue.
Western Blot: Alpha Fodrin Antibody [NBP1-53093]

Western Blot: Alpha Fodrin Antibody [NBP1-53093]

Western Blot: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in caco-2 whole cell lysate using anti-Alpha Fodrin antibody. Image from verified customer review.
Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093]

Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093]

Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate

Applications for Alpha Fodrin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Immunoprecipitation

1:10-1:500

Western Blot

1.0 ug/ml

Reviewed Applications

Read 3 reviews rated 4.7 using NBP1-53093 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Alpha Fodrin

Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Alternate Names

Alpha-II spectrin, EIEE5, FLJ17738, FLJ44613, Fodrin alpha chain, NEAS, spectrin alpha chain, brain, spectrin, alpha, non-erythrocytic 1 (alpha-fodrin), Spectrin, non-erythroid alpha chain, SPTA2

Gene Symbol

SPTAN1

UniProt

Q13813 (Human)

Additional Alpha Fodrin Products

Product Documents for Alpha Fodrin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Alpha Fodrin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Alpha Fodrin Antibody - BSA Free (3)

4.7 out of 5
3 Customer Ratings
5 Stars
67%
4 Stars
33%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Alpha Fodrin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 3 of 3 reviews Showing All
Filter By:
Clear Filters X
  • Alpha Fodrin Antibody
    Name: Praveen K D
    Application: Western Blot
    Sample Tested: primary neonatal ventricular cardiomyocytes
    Species: Mouse
    Verified Customer | Posted 10/04/2019
    Antibody at 1:1000.
    Alpha Fodrin Antibody - BSA Free NBP1-53093
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: Caco-2 cells
    Species: Human
    Verified Customer | Posted 03/25/2015
    Alpha fodrin immunoflourescence image
    Alpha Fodrin Antibody - BSA Free NBP1-53093
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Caco-2 whole cell lysate
    Species: Human
    Verified Customer | Posted 03/23/2015
    Alpha Fodrin - Western Blot
    Alpha Fodrin Antibody - BSA Free NBP1-53093

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies