alpha Glucosidase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49332

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha Glucosidase 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining in human thyroid gland and skeletal muscle tissues using anti-GANAB antibody. Corresponding GANAB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human cerebral cortex, colon, skeletal muscle and thyroid gland using Anti-GANAB antibody NBP2-49332 (A) shows similar protein distribution across tissues to independent antibody NBP1-89806 (B).
Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunocytochemistry/Immunofluorescence: alpha Glucosidase 2 Antibody [NBP2-49332] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human colon.
Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332]

Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human cerebral cortex.

Applications for alpha Glucosidase 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha Glucosidase 2

Glucosidase II is an endoplasmic reticulum localized enzyme that has an important function in the folding and maturation of glycoproteins. Glucosidase II is composed of two soluble proteins: a catalytic alpha-subunit and a beta-subunit of unknown function, both of which are highly conserved in mammals.

Alternate Names

Alpha-glucosidase 2, EC 3.2.1, EC 3.2.1.84, G2ANGLUII, Glucosidase II subunit alpha, glucosidase, alpha; neutral AB, GluII, KIAA0088alpha glucosidase II alpha subunit, neutral alpha-glucosidase AB

Gene Symbol

GANAB

Additional alpha Glucosidase 2 Products

Product Documents for alpha Glucosidase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha Glucosidase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha Glucosidase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha Glucosidase 2 Antibody - BSA Free and earn rewards!

Have you used alpha Glucosidase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...