alpha Glucosidase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35393

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human alpha Glucosidase 2 (NP_001265123.1).

Sequence:
MTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

107 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for alpha Glucosidase 2 Antibody - BSA Free

alpha Glucosidase 2 Antibody

Western Blot: alpha Glucosidase 2 Antibody [NBP3-35393] -

Western Blot: alpha Glucosidase 2 Antibody [NBP3-35393] - Western blot analysis of various lysates using alpha Glucosidase 2 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
alpha Glucosidase 2 Antibody

Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP3-35393] -

Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP3-35393] - Immunofluorescence analysis of U-2 OS cells using alpha Glucosidase 2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
alpha Glucosidase 2 Antibody

Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP3-35393] -

Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP3-35393] - Immunofluorescence analysis of NIH-3T3 cells using alpha Glucosidase 2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
alpha Glucosidase 2 Antibody

Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP3-35393] -

Immunocytochemistry/ Immunofluorescence: alpha Glucosidase 2 Antibody [NBP3-35393] - Immunofluorescence analysis of C6 cells using alpha Glucosidase 2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for alpha Glucosidase 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha Glucosidase 2

Glucosidase II is an endoplasmic reticulum localized enzyme that has an important function in the folding and maturation of glycoproteins. Glucosidase II is composed of two soluble proteins: a catalytic alpha-subunit and a beta-subunit of unknown function, both of which are highly conserved in mammals.

Alternate Names

Alpha-glucosidase 2, EC 3.2.1, EC 3.2.1.84, G2ANGLUII, Glucosidase II subunit alpha, glucosidase, alpha; neutral AB, GluII, KIAA0088alpha glucosidase II alpha subunit, neutral alpha-glucosidase AB

Gene Symbol

GANAB

Additional alpha Glucosidase 2 Products

Product Documents for alpha Glucosidase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha Glucosidase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha Glucosidase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha Glucosidase 2 Antibody - BSA Free and earn rewards!

Have you used alpha Glucosidase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...