alpha-Internexin Antibody (5E5Z3)

Novus Biologicals | Catalog # NBP3-16230

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5E5Z3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human alpha-Internexin (Q16352). EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha-Internexin Antibody (5E5Z3)

Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230]

Western Blot: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Western blot analysis of extracts of various cell lines, using alpha-Internexin Rabbit mAb (NBP3-16230) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
alpha-Internexin Antibody (5E5Z3)

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded mouse brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha-Internexin Antibody (5E5Z3)

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human appendix tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha-Internexin Antibody (5E5Z3)

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded rat brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha-Internexin Antibody (5E5Z3)

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human colon tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha-Internexin Antibody (5E5Z3)

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -

Immunohistochemistry: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunohistochemistry analysis of alpha-Internexin in paraffin-embedded human brain tissue using alpha-Internexin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
alpha-Internexin Antibody (5E5Z3)

Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -

Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunofluorescence analysis of paraffin-embedded mouse brain using alpha-Internexin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
alpha-Internexin Antibody (5E5Z3)

Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] -

Immunocytochemistry/ Immunofluorescence: alpha-Internexin Antibody (5E5Z3) [NBP3-16230] - Immunofluorescence analysis of paraffin-embedded rat brain using alpha-Internexin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for alpha-Internexin Antibody (5E5Z3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha-Internexin

Alpha-internexin is a Class IV intermediate filament, related to but distinct from the better known neurofilament triplet proteins, NF-L, NF-M and NF-H. It is expressed only in neurons and in large amounts early in neuronal development, but is down-regulated in many neurons as development procedes. However, many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H, and some mature neurons only express the alpha-internexin subunit of neurofilament.

The very early developmental expression of alpha-internexin suggests that its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage. Therefore, alpha-internexin antibodies serve as unique probes to study and classify neuronal types and follow their processes in tissue sections and culture.

Alternate Names

alphaInternexin, INA, NEF5, NF-66, TXBP-1

Gene Symbol

INA

Additional alpha-Internexin Products

Product Documents for alpha-Internexin Antibody (5E5Z3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha-Internexin Antibody (5E5Z3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha-Internexin Antibody (5E5Z3)

There are currently no reviews for this product. Be the first to review alpha-Internexin Antibody (5E5Z3) and earn rewards!

Have you used alpha-Internexin Antibody (5E5Z3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...