AlphaA Crystallin/CRYAA Antibody (1T1F5)

Name: AlphaA Crystallin/CRYAA Antibody (1T1F5)
Brand: Novus Biologicals
SKU: NBP3-16559
Price: 389 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16559

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1T1F5 expressed in HEK293

View all AlphaA Crystallin/CRYAA Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human AlphaA Crystallin/CRYAA (P02489). QHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AlphaA Crystallin/CRYAA Antibody (1T1F5)

Western Blot: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Western Blot: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559] - Western blot analysis of extracts of various cell lines, using AlphaA Crystallin/CRYAA Rabbit mAb (NBP3-16559) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559]

Immunohistochemistry: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559] - Immunofluorescence analysis of rat eye using AlphaA Crystallin/CRYAA Rabbit mAb (NBP3-16559) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559] -

Immunocytochemistry/ Immunofluorescence: AlphaA Crystallin/CRYAA Antibody (1T1F5) [NBP3-16559] - Immunofluorescence analysis of mouse eye using AlphaA Crystallin/CRYAA Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for AlphaA Crystallin/CRYAA Antibody (1T1F5)

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AlphaA Crystallin/CRYAA

Lens proteins consist almost entirely of crystallins (about 95%). Crystallins are also found vertebrate skeletal muscle tissue. In the lens, their structural function is to assist in maintaining the proper refractive index of the lens. The mammalian lens contains 3 major classes of crystallins: alpha, beta, and gamma. Alpha-crystallin is the largest of the crystallins and is composed of 2 primary gene products--alpha-A and alpha-B. There are at least 5 different proteins comprising the beta-crystallins. The gamma-crystallins are monomeric, but there are at least 5 gamma crystallins identified in bovine and rat lens. Alpha-Crystallin comprises 40% of total lens protein composition. In addition to maintaining proper refractive index, it also functions in a chaperone like manner by preventing the formation of aggregates possibly leading to cataract formation. It is believed that the phosphorylated states of the alpha-crystallin occur in response to cellular stress and may serve a structural control function and play a role in protein maintenance. Alpha-B crystallin has been linked to Alexander®s disease where it accumulates in brain cells of those afflicted.

Alternate Names

CRYA1, CRYAA, HSPB4

Gene Symbol

CRYAA

Additional AlphaA Crystallin/CRYAA Products

Product Documents for AlphaA Crystallin/CRYAA Antibody (1T1F5)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AlphaA Crystallin/CRYAA Antibody (1T1F5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Heat Shock Proteins (HSPs)

Customer Reviews for AlphaA Crystallin/CRYAA Antibody (1T1F5)

There are currently no reviews for this product. Be the first to review AlphaA Crystallin/CRYAA Antibody (1T1F5) and earn rewards!

Have you used AlphaA Crystallin/CRYAA Antibody (1T1F5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image