AMPK beta 2/PRKAB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57581

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AMPK beta 2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PRKAB2(protein kinase, AMP-activated, beta 2 non-catalytic subunit) The peptide sequence was selected from the middle region of PRKAB2 (NP_005390). Peptide sequence RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AMPK beta 2/PRKAB2 Antibody - BSA Free

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581]

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581]

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581] - Mouse Liver Dilution: 1 to 1000
Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581]

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581]

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-57581] - Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate

Applications for AMPK beta 2/PRKAB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AMPK beta 2

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Long Name

AMP-activated Protein Kinase beta 2

Alternate Names

PRKAB2

Entrez Gene IDs

5565 (Human); 108097 (Mouse); 64562 (Rat)

Gene Symbol

PRKAB2

UniProt

O43741

Additional AMPK beta 2 Products

Product Documents for AMPK beta 2/PRKAB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AMPK beta 2/PRKAB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Autophagy
Intracellular Kinases
Obesity

Customer Reviews for AMPK beta 2/PRKAB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMPK beta 2/PRKAB2 Antibody - BSA Free and earn rewards!

Have you used AMPK beta 2/PRKAB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies