Annexin A10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90156

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (95%), Rat (97%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Immunohistochemistry-Paraffin, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Annexin A10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Annexin A10 Antibody - BSA Free

Annexin A10 Antibody - BSA Free Immunohistochemistry: Annexin A10 Antibody - BSA Free [NBP1-90156]

Immunohistochemistry: Annexin A10 Antibody - BSA Free [NBP1-90156]

Analysis in human stomach and tonsil tissues using NBP1-90156 antibody. Corresponding ANXA10 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156]

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156]

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human stomach shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156]

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156]

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human tonsil shows no positivity as expected.
Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156]

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156]

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.
Annexin A10 Antibody

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] -

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] - Histological & immunohistochemical staining of type A2 TSAs. a HE staining. b A high-power view showing the TSA component (red box in Fig. 2a). c A high-power view showing the precursor component (blue box in Fig. 2a). d Positive for annexin A10 expression. e Positive for MUC2 expression. f Positive for MUC5AC expression. g Negative for MUC6 expression. h Negative for CD10 expression. i Positive for annexin A10 expression. j Positive for MUC2 expression. k Positive for MUC5AC expression. l Negative for MUC6 expression. m Negative for CD10 expression Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32535664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Annexin A10 Antibody

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] -

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] - Histological & immunohistochemical staining of type A2 TSAs. a HE staining. b A high-power view showing the TSA component (red box in Fig. 2a). c A high-power view showing the precursor component (blue box in Fig. 2a). d Positive for annexin A10 expression. e Positive for MUC2 expression. f Positive for MUC5AC expression. g Negative for MUC6 expression. h Negative for CD10 expression. i Positive for annexin A10 expression. j Positive for MUC2 expression. k Positive for MUC5AC expression. l Negative for MUC6 expression. m Negative for CD10 expression Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32535664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Annexin A10 Antibody

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] -

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] - Histological & immunohistochemical staining of type A1 TSAs. a HE staining. b A high-power view showing the TSA component (red box in Fig. 1a). c A high-power view showing the precursor component (blue box in Fig. 1a). d Positive for annexin A10 expression. e Positive for MUC2 expression. f Partially positive for MUC5AC expression. g Negative for MUC6 expression. h Negative for CD10 expression. i Negative for annexin A10 expression. j Positive for MUC2 expression. k Positive for MUC5AC expression. l Negative for MUC6 expression. m Negative for CD10 expression Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32535664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Simple Western: Annexin A10 Antibody [NBP1-90156]

Simple Western: Annexin A10 Antibody [NBP1-90156]

Simple Western: Annexin A10 Antibody [NBP1-90156] - Electropherogram image(s) of corresponding Simple Western lane view. Annexin A10 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).
Simple Western: Annexin A10 Antibody [NBP1-90156]

Simple Western: Annexin A10 Antibody [NBP1-90156]

Simple Western: Annexin A10 Antibody [NBP1-90156] - Simple Western lane view shows a specific band for ANXA10 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Annexin A10 Antibody - BSA Free Western Blot: Annexin A10 Antibody - BSA Free [NBP1-90156]

Western Blot: Annexin A10 Antibody - BSA Free [NBP1-90156]

Analysis in human stomach tissue.

Applications for Annexin A10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in U-251MG sp, separated by Size, antibody dilution of 1:20, apparent MW was 43 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reviewed Applications

Read 2 reviews rated 5 using NBP1-90156 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Annexin A10

Annexin A10 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined.

Alternate Names

ANX14, ANXA10

Entrez Gene IDs

11199 (Human)

Gene Symbol

ANXA10

UniProt

Q9UJ72

Additional Annexin A10 Products

Product Documents for Annexin A10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Annexin A10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Annexin A10 Antibody - BSA Free

Customer Reviews for Annexin A10 Antibody - BSA Free (2)

5 out of 5
2 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Annexin A10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Annexin A10 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Paraffin sections of mouse intestine
    Species: Mouse
    Verified Customer | Posted 12/08/2016
    ANXA10- IHC-Paraffin, Mouse intestinal tissue
    Annexin A10 Antibody - BSA Free NBP1-90156
  • Name: Bryan Tinsley
    Application: Immunohistochemistry
    Sample Tested:
    Species: Human
    Verified Customer | Posted 04/21/2014
    Ovary carcinoma: Nuclear and cytoplasmic staining
    Annexin A10 Antibody - BSA Free NBP1-90156

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies