Annexin A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62614

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Annexin A2 Antibody - BSA Free

Western Blot: Annexin A2 Antibody [NBP2-62614]

Western Blot: Annexin A2 Antibody [NBP2-62614]

Western Blot: Annexin A2 Antibody [NBP2-62614] - Analysis using Anti-ANXA2 antibody NBP2-62614 (A) shows similar pattern to independent antibody NBP2-62638 (B).
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614] - Staining of human kidney.
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614] - Immunohistochemistry analysis in human lung and cerebral cortex tissues using Anti-ANXA2 antibody. Corresponding ANXA2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614] - Staining of human cerebral cortex, kidney, liver and lung using Anti-ANXA2 antibody NBP2-62614 (A) shows similar protein distribution across tissues to independent antibody NBP2-62638 (B).
Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614]

Immunohistochemistry-Paraffin: Annexin A2 Antibody [NBP2-62614] - Staining of human liver.

Applications for Annexin A2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Annexin A2

The Annexins are a family of structurally similar proteins. Annexins bind to phospholipids and may be involved in regulation of membrane transport, membrane channel activity, and interaction of the cell membrane with the extracellular matrix. Annexin II is a calcium regulated, membrane binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ANX2L4, ANXA2, CAL1H, LIP2, Lipocortin-2, LPC2D, PAP-IV

Gene Symbol

ANXA2

Additional Annexin A2 Products

Product Documents for Annexin A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Annexin A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Annexin A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Annexin A2 Antibody - BSA Free and earn rewards!

Have you used Annexin A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...