Annexin A6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90149

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Annexin A6 Antibody - BSA Free

Annexin A6 Antibody - BSA Free Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Annexin A6 Antibody - BSA Free Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Annexin A6 Antibody - BSA Free Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Staining of human pancreas shows strong membranous positivity in islets of Langerhans.
Annexin A6 Antibody - BSA Free Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Immunohistochemistry: Annexin A6 Antibody - BSA Free [NBP1-90149]

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Annexin A6 Antibody - BSA Free Western Blot: Annexin A6 Antibody - BSA Free [NBP1-90149]

Western Blot: Annexin A6 Antibody - BSA Free [NBP1-90149]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Annexin A6 Antibody - BSA Free Western Blot: Annexin A6 Antibody - BSA Free [NBP1-90149]

Western Blot: Annexin A6 Antibody - BSA Free [NBP1-90149]

Analysis in human cell lines SK-MEL-30 and A-431 using Anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Annexin A6 Antibody - BSA Free

Western Blot: Annexin A6 Antibody - BSA Free [NBP1-90149] -

AnxA1, AnxA2, AnxA4, AnxA5, AnxA6, AnxA7, AnxA10, AnxA11 and AnxA13 present in the cytoskeleton fraction (Panel A) are associated with non-polysomal mRNP complexes (Panel B) of PC12 cells. Panel (A) 30 ug of the cytoskeletal fraction (lane 1) and cytoskeleton-bound polysomes (lane 2) were separated by 10% SDS-PAGE and transferred to nitrocellulose membranes. Panel (B) samples prepared from oligo (dT)-bound mRNP complexes from the cytoskeletal fraction [supernatant after centrifugation for 2 h 100,000 g above a 1 M (35%) sucrose cushion] (lanes 3 and 4), without (lane 3) or with RNase (lane 4) treatment, as indicated above the Western blots, were subjected to similar analysis. The blots were probed with antibodies against the different Anxs and against PABP1 as a marker for poly(A)-containing mRNAs, as indicated. Antibodies against the ribosomal subunit S6 were used to inform of the distribution of ribosomes. In addition, the blots were probed with antibodies against early endosomes (EEA1), late endosomes (Rab7) and recycling endosomes (Rab11). SPC25 and LAMP1 were not detectable in any of the fractions (results not shown). Visualization of the immunoreactive protein bands was performed using the ChemiDocTM XRS+ molecular imager after incubation with horseradish peroxidase (HRP)-conjugated secondary antibodies and enhanced chemiluminescence (ECL)-reagent. The blots shown are representative for results from three experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37397259), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Annexin A6 Antibody - BSA Free

Western Blot: Annexin A6 Antibody - BSA Free [NBP1-90149] -

AnxA1, AnxA2, AnxA4, AnxA5, AnxA6, AnxA7, AnxA10, AnxA11 and AnxA13 present in the cytoskeleton fraction (Panel A) are associated with non-polysomal mRNP complexes (Panel B) of PC12 cells. Panel (A) 30 ug of the cytoskeletal fraction (lane 1) and cytoskeleton-bound polysomes (lane 2) were separated by 10% SDS-PAGE and transferred to nitrocellulose membranes. Panel (B) samples prepared from oligo (dT)-bound mRNP complexes from the cytoskeletal fraction [supernatant after centrifugation for 2 h 100,000 g above a 1 M (35%) sucrose cushion] (lanes 3 and 4), without (lane 3) or with RNase (lane 4) treatment, as indicated above the Western blots, were subjected to similar analysis. The blots were probed with antibodies against the different Anxs and against PABP1 as a marker for poly(A)-containing mRNAs, as indicated. Antibodies against the ribosomal subunit S6 were used to inform of the distribution of ribosomes. In addition, the blots were probed with antibodies against early endosomes (EEA1), late endosomes (Rab7) and recycling endosomes (Rab11). SPC25 and LAMP1 were not detectable in any of the fractions (results not shown). Visualization of the immunoreactive protein bands was performed using the ChemiDocTM XRS+ molecular imager after incubation with horseradish peroxidase (HRP)-conjugated secondary antibodies and enhanced chemiluminescence (ECL)-reagent. The blots shown are representative for results from three experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37397259), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Annexin A6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Annexin A6

The Annexins constitute a family of structurally-related, relatively abundant proteins that exhibit Ca2+-dependent binding to phospholipids. Annexins function in multiple aspects of cell biology including regulation of membrane trafficking, transmembrane channel activity, inhibition of phospholipase A2, inhibition of coagulation and mediation of cell-matrix interactions. Annexin A13 is considered the original progenitor of the 12 members of vertebrate Annexins. The expression of Annexin A13 is highly tissue-specific, being expressed only in intestinal and kidney epithelial cells. This expression is associated with a highly differentiated intracellular transport function. Two alternative splicing isoforms of Annexin A13 exist, both of which bind to rafts.

Alternate Names

ANX6, ANXA6, Calelectrin, CBP68, CPB-II, Lipocortin VI

Gene Symbol

ANXA6

Additional Annexin A6 Products

Product Documents for Annexin A6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Annexin A6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Annexin A6 Antibody - BSA Free

Customer Reviews for Annexin A6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Annexin A6 Antibody - BSA Free and earn rewards!

Have you used Annexin A6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...