![Western Blot: Apc5 AntibodyBSA Free [NBP1-77154]](https://resources.rndsystems.com/images/products/Apc5-Antibody-Western-Blot-NBP1-77154-img0001.jpg "Western Blot: Apc5 AntibodyBSA Free [NBP1-77154]")
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Predicted:
Chicken (100%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Antibody was raised against a 17 amino acid synthetic peptide near the center of human APC5. The immunogen is located within amino acids 480 - 530 of APC5. Amino Acid Squence: LKHLKERFPPNSQHAQL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Apc5 Antibody - BSA Free
Western Blot: Apc5 AntibodyBSA Free [NBP1-77154]
Western Blot: Apc5 Antibody [NBP1-77154] - Human kidney tissue lysate with APC5 antibody at (A) 1 and (B) 2 ug/mL.
Immunohistochemistry: Apc5 Antibody - BSA Free [NBP1-77154] -
Immunohistochemistry: Apc5 Antibody - BSA Free [NBP1-77154] - Immunohistochemistry of Apc5 in rat kidney tissue with Apc5 antibody at 5 u/mL.
Immunocytochemistry/ Immunofluorescence: Apc5 Antibody - BSA Free [NBP1-77154] -
Immunocytochemistry/ Immunofluorescence: Apc5 Antibody - BSA Free [NBP1-77154] - Immunofluorescence of Apc5 in rat kidney tissue with Apc5 antibody at 20 u/mL.
Immunocytochemistry/ Immunofluorescence: Apc5 Antibody - BSA Free [NBP1-77154] -
Immunocytochemistry/ Immunofluorescence: Apc5 Antibody - BSA Free [NBP1-77154] - Immunofluorescence of Apc5 in rat kidney tissue with Apc5 antibody at 20 u/mL.Applications for Apc5 Antibody - BSA Free
Application
Recommended Usage
ELISA
1:100-1:2000
Immunocytochemistry/ Immunofluorescence
20 ug/ml
Immunohistochemistry
5 ug/ml
Immunohistochemistry-Paraffin
5 ug/ml
Western Blot
1-2 ug/ml
Formulation, Preparation, and Storage
Purification
Peptide affinity purified
Formulation
PBS
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Apc5
Alternate Names
anaphase promoting complex subunit 5, anaphase-promoting complex subunit 5, APC5Cyclosome subunit 5
Gene Symbol
ANAPC5
UniProt
Additional Apc5 Products
Product Documents for Apc5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Apc5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Apc5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Apc5 Antibody - BSA Free and earn rewards!
Have you used Apc5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Apc5 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I'm interested in your anti-ANAPC5 (NBP1-77154). Is the 17 aa sequence proprietary? If so, could you help me by performing a BLASTp of the recognized epitope and the bovine ANAPC5 (uniron E1BK11) and send me the results as % max ident, please? What would be your recommendation about using your Ab to detect the bovine ANAPC5?
A: It looks like the sequence location of this one has 100% identity with the Bovine sequence available on UniProt. I would think this would be a good choice for you. The reason I have selected this one is because we haven't tested any of our antibodies against this target in ICC/IF, but it has been shown to stain tissues so there is a good chance it can stain cells as well. NBP1-90136: LSQQASLLKNDETKALTPASLQKELNNLLK FNPDFAEAHYLSYLNNLRVQDVFSSTHSLL HYFDRLILTGAESKSNGEEGYGRSLR I would recommend taking advantage of our Innovators Reward Program. Our Innovator's Reward Program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure.
Loading...