Apolipoprotein A-I/ApoA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33468

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Apolipoprotein A-I/ApoA1 Antibody - BSA Free (NBP2-33468) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Apolipoprotein A-I/ApoA1 Antibody - BSA Free

Western Blot: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Western Blot: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Western Blot: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468] - Analysis in human liver tissue.
Immunocytochemistry/ Immunofluorescence: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunocytochemistry/ Immunofluorescence: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunocytochemistry/Immunofluorescence: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468] - Staining of human endometrium shows distinct positivity in plasma.
Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468] - Staining of human colon shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468]

Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-33468] - Staining of human placenta shows moderate positivity in plasma.

Applications for Apolipoprotein A-I/ApoA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein A-I/ApoA1

Apolipoprotein A1 (apo A1) is the major polypeptide of the human plasma high density lipoprotein (HDL). The structure and function of the apo A1 gene are of interest because of the inverse correlation shown between HDL levels and coronary heart disease (1). The 267 amino acid precursor initially undergoes intracellular co-translational proteolytic cleavage into proapoA-I. ProapoA-I is secreted from the cell and was isolated from thoracic duct lymph in the apoA-I1 isoform position. Results indicate that apo A1 is present in human plasma, and undergoes post-translational proteolytic cleavage to mature plasma apoA-I (2). Cleavage of this protein with cyanogen bromide yields four fragments designated in the order of elution from Bio-Gel P-30 as CNBr I, II, III, and IV (3).

Alternate Names

Alp-1, APOA1, Apolipoprotein AI, Brp-14, Ltw-1, Lvtw-1, Sep-1, Sep-2

Gene Symbol

APOA1

UniProt

Additional Apolipoprotein A-I/ApoA1 Products

Product Documents for Apolipoprotein A-I/ApoA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein A-I/ApoA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Apolipoprotein A-I/ApoA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein A-I/ApoA1 Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein A-I/ApoA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...