Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free

Novus Biologicals | Catalog # H00000345-M06

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8H7

Format

Azide and BSA Free
View all Apolipoprotein CIII Primary Antibodies »

Product Specifications

Immunogen

APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody (8H7) [H00000345-M06]

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody (8H7) [H00000345-M06]

Immunocytochemistry/Immunofluorescence: Apolipoprotein CIII Antibody (8H7) [H00000345-M06] - Analysis of monoclonal antibody to APOC3 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: Apolipoprotein CIII Antibody (8H7) [H00000345-M06]

ELISA: Apolipoprotein CIII Antibody (8H7) [H00000345-M06]

ELISA: Apolipoprotein CIII Antibody (8H7) [H00000345-M06] - Detection limit for recombinant GST tagged APOC3 is 0.3 ng/ml as a capture antibody.

Applications for Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1:100-1:2000
Application Notes
It has been used for ELISA and WB.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Apolipoprotein CIII

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Alternate Names

APOC3, APOCIII, apo-CIII, ApoC-III, Apolipoprotein C3, apolipoprotein C-III, MGC150353

Gene Symbol

APOC3

UniProt

NP_000031 (Human)

Additional Apolipoprotein CIII Products

Product Documents for Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free and earn rewards!

Have you used Apolipoprotein CIII Antibody (8H7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies