Apolipoprotein D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57684

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE

Reactivity Notes

Rat 84%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein D Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Apolipoprotein D Antibody [NBP2-57684]

Immunocytochemistry/ Immunofluorescence: Apolipoprotein D Antibody [NBP2-57684]

Immunocytochemistry/Immunofluorescence: Apolipoprotein D Antibody [NBP2-57684] - Staining of human cell line ASC TERT1 shows localization to plasma membrane. Antibody staining is shown in green.
Apolipoprotein D Antibody - BSA Free Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Apolipoprotein D Antibody - BSA Free Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Apolipoprotein D Antibody - BSA Free Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Analysis in human breast and tonsil tissues. Corresponding RNA-seq data are presented for the same tissues.
Apolipoprotein D Antibody - BSA Free Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Apolipoprotein D Antibody - BSA Free Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Apolipoprotein D Antibody - BSA Free Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684]

Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

Applications for Apolipoprotein D Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein D

The Apolipoprotein D gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoproteinsequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2microglobulin protein superfamily

Alternate Names

ApoD, Apo-D, apolipoprotein D

Gene Symbol

APOD

Additional Apolipoprotein D Products

Product Documents for Apolipoprotein D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Apolipoprotein D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein D Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...