Apolipoprotein E/ApoE Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49450

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein E/ApoE Antibody - BSA Free

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Analysis in human liver and pancreas tissues. Corresponding APOE RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human cerebral cortex, liver, pancreas and testis using Anti-APOE antibody NBP2-49450 (A) shows similar protein distribution across tissues to independent antibody NBP2-49565 (B).
Western Blot: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Western Blot: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Western Blot: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Analysis in human plasma.
Immunocytochemistry/ Immunofluorescence: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunocytochemistry/ Immunofluorescence: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunocytochemistry/Immunofluorescence: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450]

Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody [NBP2-49450] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Applications for Apolipoprotein E/ApoE Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein E/ApoE

Apolipoprotein E (APOE) is an apolipoprotein located in chylomicrons and intermediate-density lipoproteins that is necessary for the normal catabolism of triglyceride-rich lipoprotein constituents in the liver. APOE has recently been shown to be involseveral biological processes other than lipoprotein transport, including cognition and immunoregulation.

Lipoproteins are responsible for carrying cholesterol and other fats through the bloodstream as little packages and are essential for the normal breakdown of these molecules. In particular, apolipoprotein E is a major component of specific lipoproteins called very low-density lipoproteins (VLDL). A major function of VLDLs is to remove excess cholesterol from the blood and carry it to the liver for processing. Maintaining normal levels of cholesterol is essential for the prevention of cardiovascular diseases, including heart attacks and strokes.

The three Apo E isoforms are strongly associated with cardiovascular disease and Alzheimer's disease, so ApoE antibodies have become useful tools for research in both of these areas.

Alternate Names

APOE

Gene Symbol

APOE

Additional Apolipoprotein E/ApoE Products

Product Documents for Apolipoprotein E/ApoE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein E/ApoE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Apolipoprotein E/ApoE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein E/ApoE Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein E/ApoE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

A-beta Pathways: Uptake & Degradation A-beta Pathways: Uptake & Degradation Thumbnail