Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62680

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Apolipoprotein E R2/ApoE R2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680]

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein E R2/ApoE R2

Apolipoprotein E Receptor 2 (ApoER2), also known as LRP8, is a Low-density lipoprotein receptor family member involved in endocytosis and signal transduction. Specifically, ApoER-2 is responsible for the cellular recognition and internalization of ApoE containing lipoproteins, including VLDL and HDL.

ApoER2 is expressed mainly in the brain, placenta, platelets and megakaryocytic cells, but not in the liver. LRP8 mutations can cause myocardial infarction type 1 (MCI1), a condition characterized by the irreversible necrosis of heart muscle secondary to prolonged ischemia. ApoER2 may also play a role in debilitating neurodegenerative diseases such as schizophrenia and Alzheimer's disease.

ApoER2 antibodies are useful tools for studying certian cardiac and neurodegenerative diseases.

Long Name

Apolipoprotein E Receptor 2

Alternate Names

ApoER2, Lr8b, LRP-8, LRP8

Gene Symbol

LRP8

Additional Apolipoprotein E R2/ApoE R2 Products

Product Documents for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glucose Homeostasis
Obesity

Customer Reviews for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein E R2/ApoE R2 Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein E R2/ApoE R2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies