ARFIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39002

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARFIP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ARFIP1 Antibody [NBP2-39002]

Immunocytochemistry/ Immunofluorescence: ARFIP1 Antibody [NBP2-39002]

Immunocytochemistry/Immunofluorescence: ARFIP1 Antibody [NBP2-39002] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry: ARFIP1 Antibody [NBP2-39002] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002] - Staining of human endometrium shows high expression.
Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002]

Immunohistochemistry-Paraffin: ARFIP1 Antibody [NBP2-39002] - Staining in human endometrium and skeletal muscle tissues using anti-ARFIP1 antibody. Corresponding ARFIP1 RNA-seq data are presented for the same tissues.

Applications for ARFIP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARFIP1

ADP-ribosylation factors, or ARFs, enhance the ADP ribosyltransferase activity of cholera toxin and are implicated in vesicle transport between endoplasmic reticulum and the Golgi complex. Arfaptin 1 is recruited from the cytosol to Golgi membranes by ARFs in a guanosine 5'-O-(3-thiotriphosphate)-dependent and brefeldin A-sensitive manner but is not a constituent of coatomer. Arfaptin 1 binds to nonmyristoylated GTP-bound ARF3, but not to GDP-bound ARF3, and also to ARF1, another class I ARF. It binds with lower affinity to ARF5, a class II ARF, and with very little affinity to ARF6, a class III ARF. POR1 (also designated arfaptin 2) was first isolated as a Rac 1 binding protein necessary for Rac mediated Actin polymerization and the subsequent formation of membrane ruffles and lamellipodia. POR1 has also been shown to interact with the ADP ribosylation factor ARF6, a GTPase that associates with the plasma membrane and intracellular endosome vesicles, in a GTP dependent manner. The association of POR1 with ARF6 stimulates induction of Actin polymerization. POR1 appears to play a regulatory role through multiple signaling pathways in the reorganization of the cytoskeletal structure.

Alternate Names

ADP-ribosylation factor interacting protein 1, ADP-ribosylation factor-interacting protein 1, arfaptin 1, arfaptin-1, HSU52521, MGC117369

Gene Symbol

ARFIP1

UniProt

Additional ARFIP1 Products

Product Documents for ARFIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARFIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARFIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARFIP1 Antibody - BSA Free and earn rewards!

Have you used ARFIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...