Arginase 1/ARG1/liver Arginase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87490

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Arginase 1/ARG1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%). Reactivity reported in scientific literature (PMID: 18715028)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Arginase 1/ARG1/liver Arginase Antibody - BSA Free

Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Simple Western lane view shows a specific band for ARG1 in 0.2 mg/ml of Liver (left), HepG2 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining in human liver and kidney tissues. Corresponding ARG1 RNA-seq data are presented for the same tissues.
Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Analysis using Anti-ARG1 antibody NBP1-87490 (A) shows similar pattern to independent antibody NBP1-87455 (B).
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human bone marrow shows strong cytoplasmic and nuclear positivity in a subset of hematopoietic cells.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human hepatocellular carcinoma shows moderate cytoplasmic and nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490]

Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Electropherogram image(s) of corresponding Simple Western lane view. Arginase 1/ARG1/liver Arginase antibody was used at 1:50 dilution on Liver and HepG2 lysate(s).

Applications for Arginase 1/ARG1/liver Arginase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Simple Western

1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Liver, HepG2, separated by Size, antibody dilution of 1:50, apparent MW was 41 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Arginase 1/ARG1

Arginase 1 (ARG1), also known as liver arginase, is a metalloenzyme that is a member of the ureohydrolase superfamily and arginase family (1). ARG1 is known for its role in the urea cycle in catalyzing the conversion of L-arginine into urea and L-ornithine (1). Arginase has two distinct isoforms, with ARG1 being expressed primarily in the liver and ARG2 in extrahepatic tissues (1). Human ARG1 is synthesized as 322 amino acids (aa) in length with a theoretical molecular weight of 35 kDa (1,2). Three ARG1 monomers can form a highly active homotrimer of 105 kDa (1). A key structural feature of the arginase protein is the binuclear magnesium (Mn2+) ions at its core (1).

Arginase and nitric oxidase synthase (NOS) compete for the same L-arginine substrate, creating a delicate balance between pathways (1). Furthermore, bioavailability of L-arginine and ARG1 expression has been implicated in several pathologies including vascular disease, neuronal disease, cardiovascular disease, immune dysfunction, inflammation, and cancer (1,3-5). For instance, ARG1 functions as a macrophage marker, defining the M2 population, while inducible nitric oxide synthase (iNOS) characterizes the M1 population; impaired M1/M2 polarization and changes in ARG1 expression is observed in diseases such as arteriogenesis, asthma, pulmonary fibrosis, and inflammatory bowel disease (1,3). In humans, arginase deficiency, known as argininemia, is an autosomal recessive metabolic disorder characterized by elevated ammonia (hyperammonemia) levels and arginine accumulation (6). Given that many arginase-associated diseases are characterized by upregulation in expression of ARG1, ARG2, or both, arginase inhibitors are currently being studied as a potential therapeutic approach (1,4).

References

1. S Clemente, G., van Waarde, A., F Antunes, I., Domling, A., & H Elsinga, P. (2020). Arginase as a Potential Biomarker of Disease Progression: A Molecular Imaging Perspective. International Journal of Molecular Sciences. https://doi.org/10.3390/ijms21155291

2. Uniprot (P05089)

3. Kieler, M., Hofmann, M., & Schabbauer, G. (2021). More than just protein building blocks: How amino acids and related metabolic pathways fuel macrophage polarization. The FEBS Journal. Advance online publication. https://doi.org/10.1111/febs.15715

4. Shosha, E., Fouda, A. Y., Narayanan, S. P., Caldwell, R. W., & Caldwell, R. B. (2020). Is the Arginase Pathway a Novel Therapeutic Avenue for Diabetic Retinopathy?. Journal of Clinical Medicine. https://doi.org/10.3390/jcm9020425

5. Correale J. (2021). Immunosuppressive Amino-Acid Catabolizing Enzymes in Multiple Sclerosis. Frontiers in Immunology. https://doi.org/10.3389/fimmu.2020.600428

6. Morales, J. A., & Sticco, K. L. (2020). Arginase Deficiency. In StatPearls. StatPearls Publishing.

Long Name

Liver-Type Arginase

Alternate Names

AI, ARG1, Arginase-1, Liver Arginase, PGIF, Type I Arginase

Gene Symbol

ARG1

Additional Arginase 1/ARG1 Products

Product Documents for Arginase 1/ARG1/liver Arginase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Arginase 1/ARG1/liver Arginase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Arginase 1/ARG1/liver Arginase Antibody - BSA Free

Customer Reviews for Arginase 1/ARG1/liver Arginase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Arginase 1/ARG1/liver Arginase Antibody - BSA Free and earn rewards!

Have you used Arginase 1/ARG1/liver Arginase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies