ASCL4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-92741
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ASCL4 (NP_982260.3). METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ASCL4 Antibody - BSA Free
Western Blot: ASCL4 AntibodyAzide and BSA Free [NBP2-92741]
Western Blot: ASCL4 Antibody [NBP2-92741] - Analysis of extracts of various cell lines, using ASCL4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]
Immunohistochemistry-Paraffin: ASCL4 Antibody [NBP2-92741] - Human lung cancer using ASCL4 antibody at dilution of 1:100 (40x lens)..Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]
Immunohistochemistry-Paraffin: ASCL4 Antibody [NBP2-92741] - Human appendix using ASCL4 antibody at dilution of 1:100 (40x lens).Immunohistochemistry-Paraffin: ASCL4 Antibody - Azide and BSA Free [NBP2-92741]
Immunohistochemistry-Paraffin: ASCL4 Antibody [NBP2-92741] - Human breast cancer using ASCL4 antibody at dilution of 1:100 (40x lens).Western Blot: ASCL4 Antibody - BSA Free [NBP2-92741] -
Inhibition of TRIM72 partially reverses the inhibitory effect of MLL1 inhibition on ferroptosis of HTR-8/SVneo cells. HTR-8/SVneo cells were transfected with sh-TRIM72, with sh-NC as the control. A: Detection of transfection efficiency by qRT-PCR; then HTR-8/SVneo cells were treated with sh-MLL1 for a combined experiment. B: Detection of TRIM72, ASCL4, GPX4, and FTH1 expressions in cells by Western blot. C: Detection of cell viability by CCK-8 assay. D-F: Detection of MDA, Fe2+, and GSH levels in cells by kits. G: Detection of ROS levels in cells by fluorescence. H: Detection of cell invasion and migration by Transwell. The cell experiments were repeated three times independently. Data in panel A were analyzed by t test. Data in panels CDEFGH were analyzed by one-way ANOVA, and data in panel B were analyzed by two-way ANOVA, followed by Tukey’s multiple comparisons test. *P < 0.05, **P < 0.01 Image collected and cropped by CiteAb from the following open publication (https://biologydirect.biomedcentral.com/articles/10.1186/s13062-024-005…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: ASCL4 Antibody - BSA Free [NBP2-92741] -
Overexpression of RBM15 partially reverses the inhibitory effect of MLL1 inhibition on ferroptosis of HTR-8/SVneo cells. HTR-8/SVneo cells were transfected with oe-RBM15, with oe-NC as the control. A: Detection of transfection efficiency by qRT-PCR; then HTR-8/SVneo cells were treated with sh-MLL1 for a combined experiment. B: Detection of RBM15, TRIM72, ASCL4, GPX4, and FTH1 in cells by Western blot. C: Detection of cell viability by CCK-8 assay. D-F: Detection of MDA, Fe2+, and GSH levels in cells by kits. G: Detection of ROS levels in cells by fluorescence. H: Detection of cell invasion and migration by Transwell. The cell experiments were repeated three times independently. Data in panel A were analyzed by t test. Data in panels CDEFGH were analyzed by one-way ANOVA, and data in panel B were analyzed by two-way ANOVA, followed by Tukey’s multiple comparisons test. *P < 0.05, **P < 0.01 Image collected and cropped by CiteAb from the following open publication (https://biologydirect.biomedcentral.com/articles/10.1186/s13062-024-005…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: ASCL4 Antibody - BSA Free [NBP2-92741] -
Overexpression of ADAM9 partially reverses the inhibitory effect of MLL1 inhibition on ferroptosis of HTR-8/SVneo cells. HTR-8/SVneo cells were transfected with oe-ADAM9, with oe-NC as the control. A: Detection of transfection efficiency by qRT-PCR; then HTR-8/SVneo cells were treated with sh-MLL1 for a combined experiment. B: Detection of ADAM9, ASCL4, GPX4, and FTH1 expressions in cells by Western blot. C: Detection of cell viability by CCK-8 assay. D-F: Detection of MDA, Fe2+, and GSH levels in cells by kits. G: Detection of ROS levels in cells by fluorescence. H: Detection of cell invasion and migration by Transwell. The cell experiments were repeated three times independently. Data in panel A were analyzed by t test. Data in panels CDEFGH were analyzed by one-way ANOVA, and data in panel B were analyzed by two-way ANOVA, followed by Tukey’s multiple comparisons test. *P < 0.05, **P < 0.01 Image collected and cropped by CiteAb from the following open publication (https://biologydirect.biomedcentral.com/articles/10.1186/s13062-024-005…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ASCL4 Antibody - BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunohistochemistry
1:50-1:100
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ASCL4
Alternate Names
achaete-scute complex homolog 4 (Drosophila), bHLHa44, class A basic helix-loop-helix protein 44, class II bHLH protein ASCL4
Gene Symbol
ASCL4
Additional ASCL4 Products
Product Documents for ASCL4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ASCL4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCitations for ASCL4 Antibody - BSA Free
Customer Reviews for ASCL4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ASCL4 Antibody - BSA Free and earn rewards!
Have you used ASCL4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...