ATG14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-04664

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 340-440 of human ATG14 (NP_055739.2). SKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATG14 Antibody - BSA Free

ATG14 Antibody - Azide and BSA Free

Western Blot: ATG14 Antibody - Azide and BSA Free [ATG14] -

Western Blot: ATG14 Antibody - Azide and BSA Free [ATG14] - Western blot analysis of various lysates using ATG14 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
ATG14 Antibody - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: ATG14 Antibody [NBP3-04664] -

Immunocytochemistry/Immunofluorescence: ATG14 Antibody [NBP3-04664] - Analysis of U2OS cells using ATG14 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ATG14 Antibody - Azide and BSA Free

Western Blot: ATG14 Antibody [NBP3-04664] -

Western Blot: ATG14 Antibody [NBP3-04664] - Analysis of extracts of Neuro-2a cells, using ATG14 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.

Applications for ATG14 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATG14

Alternate Names

ATG14 Autophagy Related 14 Homolog, ATG14 Autophagy Related 14 Homolog (S. Cerevisiae), ATG14L, Autophagy Related 14, Autophagy-Related Protein 14-Like Protein, Barkor, Beclin 1-Associated Autophagy-Related Key Regulator, Beclin 1-interacting protein, KIAA0831

Gene Symbol

ATG14

Additional ATG14 Products

Product Documents for ATG14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATG14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ATG14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATG14 Antibody - BSA Free and earn rewards!

Have you used ATG14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...