ATP Citrate Lyase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90268

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATP Citrate Lyase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

121 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP Citrate Lyase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATP Citrate Lyase Antibody [NBP1-90268]

Immunocytochemistry/ Immunofluorescence: ATP Citrate Lyase Antibody [NBP1-90268]

Immunocytochemistry/Immunofluorescence: ATP Citrate Lyase Antibody [NBP1-90268] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268] - Staining of human kidney, pancreas, prostate and testis using Anti-ACLY antibody NBP1-90268 (A) shows similar protein distribution across tissues to independent antibody NBP1-90267 (B).
Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268]

Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90268] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Western Blot: ATP Citrate Lyase Antibody [NBP1-90268]

Western Blot: ATP Citrate Lyase Antibody [NBP1-90268]

Western Blot: ATP Citrate Lyase Antibody [NBP1-90268] - Analysis using Anti-ACLY antibody NBP1-90268 (A) shows similar pattern to independent antibody NBP1-90267 (B).
ATP Citrate Lyase Antibody - BSA Free Western Blot: ATP Citrate Lyase Antibody - BSA Free [NBP1-90268]

Western Blot: ATP Citrate Lyase Antibody - BSA Free [NBP1-90268]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
ATP Citrate Lyase Antibody - BSA Free Western Blot: ATP Citrate Lyase Antibody - BSA Free [NBP1-90268]

Western Blot: ATP Citrate Lyase Antibody - BSA Free [NBP1-90268]

Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for ATP Citrate Lyase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP Citrate Lyase

ATP citrate lyase (ACLY), also known as ATP citrate synthase, is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer of four identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. One of these products, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. NDPK has been found to phosphorylate ACLY and insulin to increase phosphorylation of ACLY (2).

Long Name

ATP-citrate synthase

Alternate Names

ACLY, EC 2.3.3.8

Entrez Gene IDs

47 (Human)

Gene Symbol

ACLY

UniProt

P53396 (Human)

Additional ATP Citrate Lyase Products

Product Documents for ATP Citrate Lyase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP Citrate Lyase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP Citrate Lyase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP Citrate Lyase Antibody - BSA Free and earn rewards!

Have you used ATP Citrate Lyase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies