ATP5O Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32602

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP5O Antibody - BSA Free

Western Blot: ATP5O Antibody [NBP2-32602]

Western Blot: ATP5O Antibody [NBP2-32602]

Western Blot: ATP5O Antibody [NBP2-32602] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602] - Staining in human kidney and pancreas tissues using anti-ATP5O antibody. Corresponding ATP5O RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602] - Staining of human pancreas shows low expression as expected.

Applications for ATP5O Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5O

ATP5O is a 213 amino acid F-type ATPase protein that is involved in producing ATP from ADP in the mitochondrial membrane when a proton gradient has been established across the membrane through the movement of charges across an electron transport complex in the respiratory chain. Current research is being performed on several diseases and disorders including graves disease, hashimotos thyroiditis, hypothyroidism, autoimmunity, goiter, diabetes mellitus, Huntington's disease, stomach cancer, osteoporosis, Parkinsons, twinning, osteosarcoma, hepatitis, and malaria. This protein has also been shown to have interactions with ATP5A1, ATP5B, ATP5D, IKBKG, and MPG in pathways such as the oxidative phosphorylation, metabolic, citric acid cycle (TCA), and Alzheimer's pathways.

Alternate Names

ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit, human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial, Oligomycin sensitivity conferral protein, oligomycin sensitivity conferring protein, OSCPhuman ATP synthase OSCP subunit

Gene Symbol

ATP5PO

Additional ATP5O Products

Product Documents for ATP5O Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP5O Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5O Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP5O Antibody - BSA Free and earn rewards!

Have you used ATP5O Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...