Axotrophin Antibody (2B9) - Azide and BSA Free

Novus Biologicals | Catalog # H00064844-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2B9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

MARCH7 (NP_073737, 66 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG

Specificity

MARCH7 (2B9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for Axotrophin Antibody (2B9) - Azide and BSA Free

Western Blot: Axotrophin Antibody (2B9) [H00064844-M01]

Western Blot: Axotrophin Antibody (2B9) [H00064844-M01]

Western Blot: Axotrophin Antibody (2B9) [H00064844-M01] - MARCH7 monoclonal antibody (M01), clone 2B9 Analysis of MARCH7expression in K-562.
Immunocytochemistry/ Immunofluorescence: Axotrophin Antibody (2B9) [H00064844-M01]

Immunocytochemistry/ Immunofluorescence: Axotrophin Antibody (2B9) [H00064844-M01]

Immunocytochemistry/Immunofluorescence: Axotrophin Antibody (2B9) [H00064844-M01] - Analysis of monoclonal antibody to MARCH7 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Axotrophin Antibody (2B9) [H00064844-M01]

ELISA: Axotrophin Antibody (2B9) [H00064844-M01]

ELISA: Axotrophin Antibody (2B9) [H00064844-M01] - Detection limit for recombinant GST tagged MARCH7 is approximately 0.03ng/ml as a capture antibody.

Applications for Axotrophin Antibody (2B9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Axotrophin

E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligasesaccept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer theubiquitin to targeted substrates

Alternate Names

AXO, AXOT, Axotrophin, E3 ubiquitin-protein ligase MARCH7, EC 6.3.2, EC 6.3.2.-, MARCH-VIIDKFZp586F1122, membrane-associated ring finger (C3HC4) 7, Membrane-associated RING finger protein 7, Membrane-associated RING-CH protein VII, RING finger protein 177, RNF177axotrophin

Entrez Gene IDs

64844 (Human)

Gene Symbol

MARCH7

Additional Axotrophin Products

Product Documents for Axotrophin Antibody (2B9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Axotrophin Antibody (2B9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Axotrophin Antibody (2B9) - Azide and BSA Free

Customer Reviews for Axotrophin Antibody (2B9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Axotrophin Antibody (2B9) - Azide and BSA Free and earn rewards!

Have you used Axotrophin Antibody (2B9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...