BRD2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84310
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit BRD2 Antibody - BSA Free (NBP1-84310) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BRD2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for BRD2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: BRD2 Antibody [NBP1-84310]
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-84310] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310]
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310]
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310]
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310]
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.Applications for BRD2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BRD2
BRD2 and the other BET proteins have been implicated in a variety of diseases and pathologies. The BET proteins are known drivers of cancer through mutation and over-expression (1). Recently, in studies examining the role of Type 2 diabetes and obesity in breast cancer progression, the BET proteins have been shown to be critical regulators of metabolism and metastasis and are co-activators for the transcription of genes that encode pro-inflammatory cytokines in immune cells infiltrating the breast cancer microenvironment (1). Accordingly, knockdown of Brd2 in mice protected the animals from developing Type 2 diabetes and stopped the inflammatory response typically elicited by obesity (4). BRD2 is also highly expressed in the brain and the gene has been shown to play a role in juvenile myoclonic epilepsy, a common form of epilepsy that typically reveals itself during adolescence (5). In addition to the brain, BRD2 is highly expressed in the bone marrow and consequently its kinase activity has been shown to increase upon cellular proliferation and is significantly elevated in the peripheral blood lymphocytes of lymphoma patients (2, 3).
Research has been done to better understand protein interactions with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of the novel coronavirus disease 2019 (COVID-19), as possible targets for drug therapies. It was recently described that that the transmembrane envelope protein (E) of SARS-CoV-2 binds to both BRD2 and BRD4, suggesting that bromodomain inhibitors could be a potential drug target (6). More specifically, the bromodomain inhibitors could be relevant regarding the secondary immune-related consequences that arise from SARS-CoV-2 infection (6). Bromodomain inhibitors are currently the focus of multiple clinical trials as a potential therapeutic in cancer and pulmonary arterial hypertension (6).
References
1. Andrieu, G.P., Shafran, J.S., Deeney, J.T., Bharadwaj, K.R., Rangarajan, A., & Denis, G.V. (2018). BET proteins in abnormal metabolism, inflammation, and the breast cancer microenvironment. J Leukoc Biol. https://doi:10.1002/JLB.5RI0917-380RR
2. BRD2 bromodomain 2 (human), NCBI
3. Taniguchi, Y. (2016). The Bromodomain and Extra-Terminal Domain (BET) Family: Functional Anatomy of BET Paralogous Proteins. Int J Mol Sci. https://doi:10.3390/ijms17111849
4. Wang, F., Deeney, J.T., & Denis, G.V. (2013). Brd2 gene disruption causes "metabolically healthy" obesity: epigenetic and chromatin-based mechanisms that uncouple obesity from type 2 diabetes. Vitam Horm. https://doi:10.1016/B978-0-12-407766-9.00003-1
5. Gilsoul, M., Grisar, T., Delgado-Escueta, A.V., de Nijs, L., & Lakaye, B. (2019). Subtle Brain Developmental Abnormalities in the Pathogenesis of Juvenile Myoclonic Epilepsy. Front Cell Neurosci. https://doi:10.3389/fncel.2019.00433
6. Harrison, C. (2020). Drug researchers pursue new lines of attack against COVID-19. Nat Biotechnol. https://doi.org/10.1038/d41587-020-00013-z
Long Name
Bromodomain Containing 2
Alternate Names
FSRG1, RING3, RNF3
Gene Symbol
BRD2
Additional BRD2 Products
Product Documents for BRD2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BRD2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for BRD2 Antibody - BSA Free
Customer Reviews for BRD2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BRD2 Antibody - BSA Free and earn rewards!
Have you used BRD2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...