BRUNOL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35858

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human BRUNOL5 (NP_001166144.1).

Sequence:
MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for BRUNOL5 Antibody - BSA Free

BRUNOL5 Antibody

Immunocytochemistry/ Immunofluorescence: BRUNOL5 Antibody [NBP3-35858] -

Immunocytochemistry/ Immunofluorescence: BRUNOL5 Antibody [NBP3-35858] - Immunofluorescence analysis of L929 cells using BRUNOL5 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
BRUNOL5 Antibody

Western Blot: BRUNOL5 Antibody [NBP3-35858] -

Western Blot: BRUNOL5 Antibody [NBP3-35858] - Western blot analysis of various lysates using BRUNOL5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.

Applications for BRUNOL5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BRUNOL5

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. [provided by RefSeq]

Alternate Names

Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5

Gene Symbol

CELF5

Additional BRUNOL5 Products

Product Documents for BRUNOL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRUNOL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRUNOL5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRUNOL5 Antibody - BSA Free and earn rewards!

Have you used BRUNOL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...