Bub3 Antibody (10G1S6)

Novus Biologicals | Catalog # NBP3-16709

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10G1S6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bub3 (O43684). MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Bub3 Antibody (10G1S6)

Western Blot: Bub3 Antibody (10G1S6) [NBP3-16709]

Western Blot: Bub3 Antibody (10G1S6) [NBP3-16709]

Western Blot: Bub3 Antibody (10G1S6) [NBP3-16709] - Western blot analysis of extracts of various cell lines, using Bub3 Rabbit mAb (NBP3-16709) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709]

Immunocytochemistry/ Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709]

Immunocytochemistry/Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunofluorescence analysis of U-2 OS cells using Bub3 Rabbit mAb (NBP3-16709) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709]

Immunocytochemistry/ Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709]

Immunocytochemistry/Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunofluorescence analysis of C6 cells using Bub3 Rabbit mAb (NBP3-16709) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Bub3 Antibody (10G1S6)

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] -

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded rat brain tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Bub3 Antibody (10G1S6)

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] -

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded human colon carcinoma tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Bub3 Antibody (10G1S6)

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] -

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded human colon tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Bub3 Antibody (10G1S6)

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] -

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded mouse brain tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Bub3 Antibody (10G1S6)

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] -

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded rat spleen tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Bub3 Antibody (10G1S6)

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] -

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded mouse lung tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Bub3 Antibody (10G1S6)

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] -

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded rat colon tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Bub3 Antibody (10G1S6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Bub3

The mitotic checkpoint protein Bub3 appears to be essential during normal mitotic progression, preventing premature sister chromatid separation, missegreation and aneuploidy. Bub3 is also important during G2 and early mitosis stages, promoting normal mitotic entry. Loss of Bub3 function causes slower progression through prophase, apparently due to mitotic cyclins A and B not being accumulated.

Long Name

BUB3 Budding Uninhibited By Benzimidazoles 1 Homolog

Alternate Names

BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog, BUB3 budding uninhibited by benzimidazoles 3 homolog, BUB3L, budding uninhibited by benomyl, budding uninhibited by benzimidazoles 3 homolog (yeast), hBUB3, mitotic checkpoint component, mitotic checkpoint protein BUB3

Gene Symbol

BUB3

Additional Bub3 Products

Product Documents for Bub3 Antibody (10G1S6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Bub3 Antibody (10G1S6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Bub3 Antibody (10G1S6)

There are currently no reviews for this product. Be the first to review Bub3 Antibody (10G1S6) and earn rewards!

Have you used Bub3 Antibody (10G1S6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...