c-Myc-responsive protein Rcl Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85181

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all c-Myc-responsive protein Rcl Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for c-Myc-responsive protein Rcl Antibody - BSA Free

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Analysis in control (vector only transfected HEK293T lysate) and DNPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Staining in human duodenum and testis tissues using anti-DNPH1 antibody. Corresponding DNPH1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85181] - Staining of human testis shows low expression as expected.

Applications for c-Myc-responsive protein Rcl Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: c-Myc-responsive protein Rcl

C6orf108 was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1).

Alternate Names

chromosome 6 open reading frame 108, c-Myc-responsive protein Rcl, deoxyribonucleoside 5'-monophosphate N-glycosidase, dJ330M21.3, EC 3.2.2, EC 3.2.2.-, putative c-Myc-responsive, RCL, RP3-330M21.3

Gene Symbol

DNPH1

Additional c-Myc-responsive protein Rcl Products

Product Documents for c-Myc-responsive protein Rcl Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for c-Myc-responsive protein Rcl Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for c-Myc-responsive protein Rcl Antibody - BSA Free

There are currently no reviews for this product. Be the first to review c-Myc-responsive protein Rcl Antibody - BSA Free and earn rewards!

Have you used c-Myc-responsive protein Rcl Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies