C19orf47 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91722

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for C19orf47 Antibody - BSA Free

Western Blot: C19orf47 Antibody [NBP1-91722]

Western Blot: C19orf47 Antibody [NBP1-91722]

Western Blot: C19orf47 Antibody [NBP1-91722] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: C19orf47 Antibody [NBP1-91722]

Immunohistochemistry-Paraffin: C19orf47 Antibody [NBP1-91722]

Immunohistochemistry-Paraffin: C19orf47 Antibody [NBP1-91722] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Western Blot: C19orf47 Antibody [NBP1-91722]

Western Blot: C19orf47 Antibody [NBP1-91722]

Western Blot: C19orf47 Antibody [NBP1-91722] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
C19orf47 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: C19orf47 Antibody - BSA Free [NBP1-91722]

Immunocytochemistry/ Immunofluorescence: C19orf47 Antibody - BSA Free [NBP1-91722]

Staining of human cell line MCF7 shows localization to nucleoplasm.
C19orf47 Antibody - BSA Free Western Blot: C19orf47 Antibody - BSA Free [NBP1-91722]

Western Blot: C19orf47 Antibody - BSA Free [NBP1-91722]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
C19orf47 Antibody - BSA Free Western Blot: C19orf47 Antibody - BSA Free [NBP1-91722]

Western Blot: C19orf47 Antibody - BSA Free [NBP1-91722]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4

Applications for C19orf47 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: C19orf47

Alternate Names

chromosome 19 open reading frame 47, DKFZp686P05129, FLJ36888, hypothetical protein LOC126526

Gene Symbol

C19ORF47

Additional C19orf47 Products

Product Documents for C19orf47 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for C19orf47 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for C19orf47 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review C19orf47 Antibody - BSA Free and earn rewards!

Have you used C19orf47 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...