Cadherin-17 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88239
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cadherin-17 Antibody - BSA Free
Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239]
Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239] - Staining of human colon, duodenum, kidney and liver using Anti-Cadherin-17 antibody NBP1-88239 (A) shows similar protein distribution across tissues to independent antibody NBP1-88238 (B).Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88239]
Staining of human duodenum shows strong membranous positivity in glandular cells.Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88239]
Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88239]
Staining of human kidney shows no positivity in cells in tubules as expected.Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88239]
Staining of human colon shows strong membranous positivity in glandular cells.Simple Western: Cadherin-17 Antibody [NBP1-88239]
Simple Western: Cadherin-17 Antibody [NBP1-88239] - Simple Western lane view shows a specific band for Cadherin-17 in 0.2 mg/ml of Colo205 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.Simple Western: Cadherin-17 Antibody [NBP1-88239]
Simple Western: Cadherin-17 Antibody [NBP1-88239] - Electropherogram image of the corresponding Simple Western lane view. Cadherin-17 antibody was used at 1:20 dilution on Colo205 lysate(s) respectively.Western Blot: Cadherin-17 Antibody - BSA Free [NBP1-88239]
Analysis in human cell line CACO-2.Applications for Cadherin-17 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Simple Western
1:20
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Colo205 lysates, separated by Size, antibody dilution of 1:20
See Simple Western Antibody Database for Simple Western validation: Tested in Colo205 lysates, separated by Size, antibody dilution of 1:20
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Cadherin-17
Alternate Names
Cadherin17, CDH17
Gene Symbol
CDH17
Additional Cadherin-17 Products
Product Documents for Cadherin-17 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cadherin-17 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Cadherin-17 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Cadherin-17 Antibody - BSA Free and earn rewards!
Have you used Cadherin-17 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...