Calcium-binding-protein-P22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35602

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Calcium-binding-protein-P22 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Calcium-binding-protein-P22 (NP_009167.1).

Sequence:
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Calcium-binding-protein-P22 Antibody - BSA Free

Calcium-binding-protein-P22 Antibody

Immunocytochemistry/ Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP3-35602] -

Immunocytochemistry/ Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP3-35602] - Immunofluorescence analysis of L929 cells using Calcium-binding-protein-P22 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Calcium-binding-protein-P22 Antibody

Western Blot: Calcium-binding-protein-P22 Antibody [NBP3-35602] -

Western Blot: Calcium-binding-protein-P22 Antibody [NBP3-35602] - Western blot analysis of various lysates using Calcium-binding-protein-P22 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.
Calcium-binding-protein-P22 Antibody

Immunocytochemistry/ Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP3-35602] -

Immunocytochemistry/ Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP3-35602] - Immunofluorescence analysis of U-2 OS cells using Calcium-binding-protein-P22 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Calcium-binding-protein-P22 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Calcium-binding-protein-P22

Calcium-binding-protein-P22 encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq]

Alternate Names

Calcineurin B homolog, Calcineurin homologous protein, calcium binding protein P22, Calcium-binding protein CHP, calcium-binding protein p22, SLC9A1 binding protein, SLC9A1BP

Gene Symbol

CHP1

Additional Calcium-binding-protein-P22 Products

Product Documents for Calcium-binding-protein-P22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Calcium-binding-protein-P22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calcium-binding-protein-P22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calcium-binding-protein-P22 Antibody - BSA Free and earn rewards!

Have you used Calcium-binding-protein-P22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies