CaMKII beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88212

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CaMKII beta Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CaMKII beta Antibody - BSA Free

Immunohistochemistry: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of mouse brain shows moderate to strong positivity in more than 75 % of neurons in the cerebral cortex.
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Analysis in human cerebral cortex and placenta tissues. Corresponding RNA-seq data are presented for the same tissues
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212]

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human heart shows weak to moderate cytoplasmic positivity in cardiomyocytes.
Simple Western: CaMKII beta Antibody [NBP1-88212]

Simple Western: CaMKII beta Antibody [NBP1-88212]

Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a specific band for CaMKII beta in 0.2 mg/ml of H. Motor Cortex lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.
Simple Western: CaMKII beta Antibody [NBP1-88212]

Simple Western: CaMKII beta Antibody [NBP1-88212]

Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the corresponding Simple Western lane view. CaMKII beta antibody was used at 1:5 dilution on H. Motor Cortex lysate(s) respectively.
CaMKII beta Antibody - BSA Free Western Blot: CaMKII beta Antibody - BSA Free [NBP1-88212]

Western Blot: CaMKII beta Antibody - BSA Free [NBP1-88212]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
CaMKII beta Antibody - BSA Free Western Blot: CaMKII beta Antibody - BSA Free [NBP1-88212]

Western Blot: CaMKII beta Antibody - BSA Free [NBP1-88212]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for CaMKII beta Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:5

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in H. Motor Cortex lysates, separated by Size, antibody dilution of 1:5

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CaMKII beta

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Eight transcript variants encoding eight distinct isoforms have been identified for this gene.

Long Name

Calcium/calmodulin-dependent protein kinase type II subunit beta

Alternate Names

CAM2, CAMKB, EC 2.7.11.17

Gene Symbol

CAMK2B

Additional CaMKII beta Products

Product Documents for CaMKII beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CaMKII beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CaMKII beta Antibody - BSA Free

Customer Reviews for CaMKII beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CaMKII beta Antibody - BSA Free and earn rewards!

Have you used CaMKII beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies