CaMKIV Antibody (1G4P4)

Novus Biologicals | Catalog # NBP3-16802

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1G4P4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 374-473 of human CAMKIV (Q16566). EGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CaMKIV Antibody (1G4P4)

Western Blot: CaMKIV Antibody (1G4P4) [NBP3-16802]

Western Blot: CaMKIV Antibody (1G4P4) [NBP3-16802]

Western Blot: CaMKIV Antibody (1G4P4) [NBP3-16802] - Western blot analysis of extracts of various cell lines, using CaMKIV antibody (NBP3-16802) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802]

Immunocytochemistry/ Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802]

Immunocytochemistry/Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunofluorescence analysis of U-2 OS cells using CaMKIV Rabbit mAb (NBP3-16802) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802]

Immunocytochemistry/ Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802]

Immunocytochemistry/Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunofluorescence analysis of NIH-3T3 cells using CaMKIV Rabbit mAb (NBP3-16802) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
CaMKIV Antibody (1G4P4)

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] -

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat testis tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CaMKIV Antibody (1G4P4)

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] -

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat brain tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CaMKIV Antibody (1G4P4)

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] -

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat kidney tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CaMKIV Antibody (1G4P4)

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] -

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded mouse colon tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CaMKIV Antibody (1G4P4)

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] -

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded mouse brain tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CaMKIV Antibody (1G4P4)

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] -

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat colon tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CaMKIV Antibody (1G4P4)

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] -

Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded human breast cancer tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for CaMKIV Antibody (1G4P4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CaMKIV

The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.

Alternate Names

brain Ca(2+)-calmodulin-dependent protein kinase type IV, brain Ca++-calmodulin-dependent protein kinase type IV, calcium/calmodulin-dependent protein kinase IV, calcium/calmodulin-dependent protein kinase type IV, calcium/calmodulin-dependent protein kinase type IV catalytic chain, CAM kinase- GR, CAM kinase IV, CaM kinase-GR, caMK, CaMK IV, CaMK-GR, EC 2.7.11, EC 2.7.11.17, IV, MGC36771

Gene Symbol

CAMK4

Additional CaMKIV Products

Product Documents for CaMKIV Antibody (1G4P4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CaMKIV Antibody (1G4P4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CaMKIV Antibody (1G4P4)

There are currently no reviews for this product. Be the first to review CaMKIV Antibody (1G4P4) and earn rewards!

Have you used CaMKIV Antibody (1G4P4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...