Carbonic Anhydrase III/CA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88227

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carbonic Anhydrase III/CA3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Staining in human skeletal muscle and heart muscle tissues using anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Staining of human heart muscle shows low expression as expected.
Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227]

Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Analysis using Anti-CA3 antibody NBP1-88227 (A) shows similar pattern to independent antibody NBP1-88228 (B).
Carbonic Anhydrase III/CA3 Antibody - BSA Free Western Blot: Carbonic Anhydrase III/CA3 Antibody - BSA Free [NBP1-88227]

Western Blot: Carbonic Anhydrase III/CA3 Antibody - BSA Free [NBP1-88227]

Analysis in control (vector only transfected HEK293T lysate) and CA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for Carbonic Anhydrase III/CA3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase III/CA3

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Alternate Names

CA3

Gene Symbol

CA3

Additional Carbonic Anhydrase III/CA3 Products

Product Documents for Carbonic Anhydrase III/CA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbonic Anhydrase III/CA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Carbonic Anhydrase III/CA3 Antibody - BSA Free

Customer Reviews for Carbonic Anhydrase III/CA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbonic Anhydrase III/CA3 Antibody - BSA Free and earn rewards!

Have you used Carbonic Anhydrase III/CA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...