Carbonic Anhydrase VI Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87537

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carbonic Anhydrase VI Antibody - BSA Free

Western Blot: Carbonic Anhydrase VI Antibody [NBP1-87537]

Western Blot: Carbonic Anhydrase VI Antibody [NBP1-87537]

Western Blot: Carbonic Anhydrase VI Antibody [NBP1-87537] - Analysis in control (vector only transfected HEK293T lysate) and CA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human salivary gland shows strong cytoplasmic and extra cellular positivity in glandular cells.
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining in human salivary gland and colon tissues using anti-CA6 antibody. Corresponding CA6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human colon, liver, lymph node and salivary gland using Anti-CA6 antibody NBP1-87537 (A) shows similar protein distribution across tissues to independent antibody NBP1-87536 (B).
Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537]

Immunohistochemistry-Paraffin: Carbonic Anhydrase VI Antibody [NBP1-87537] - Staining of human liver.

Applications for Carbonic Anhydrase VI Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase VI

Carbonic Anhydrase VI is encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq]

Alternate Names

CA6, Gustin

Gene Symbol

CA6

Additional Carbonic Anhydrase VI Products

Product Documents for Carbonic Anhydrase VI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbonic Anhydrase VI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbonic Anhydrase VI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbonic Anhydrase VI Antibody - BSA Free and earn rewards!

Have you used Carbonic Anhydrase VI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...