Carboxylesterase 1 hydrolyzes ester- and amide bonds of substrates ranging from small molecule esters such as phenylester to long-chain fatty acid esters and thioesters. It plays a major role in the pharmacokinetic behavior of many therapeutic agents containing an ester. Through de-esterification, it participates in the detoxification of drugs such as cocaine and heroin in serum and liver.
Carboxylesterase 1/CES1 Antibody (7C9R6)
Novus Biologicals | Catalog # NBP3-15388
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7C9R6 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Carboxylesterase 1/CES1 (P23141). MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Carboxylesterase 1/CES1 Antibody (7C9R6)
Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]
Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388] - Western blot analysis of extracts of various cell lines, using Carboxylesterase 1/CES1 Rabbit mAb (NBP3-15388) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]
Immunocytochemistry/Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388] - Immunofluorescence analysis of HeLa cells using Carboxylesterase 1/CES1 Rabbit mAb (NBP3-15388) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]
Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388] - Western blot analysis of extracts of HepG2 cells, using Carboxylesterase 1/CES1 Rabbit mAb (NBP3-15388) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] -
Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] - Confocal imaging of paraffin-embedded Mouse liver tissue using Carboxylesterase 1/CES1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] -
Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] - Confocal imaging of paraffin-embedded Rat liver tissue using Carboxylesterase 1/CES1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for Carboxylesterase 1/CES1 Antibody (7C9R6)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Carboxylesterase 1/CES1
Alternate Names
ACAT, CES1, Egasyn, HMSE1, REH, SES1, TGH
Gene Symbol
CES1
Additional Carboxylesterase 1/CES1 Products
Product Documents for Carboxylesterase 1/CES1 Antibody (7C9R6)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Carboxylesterase 1/CES1 Antibody (7C9R6)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Carboxylesterase 1/CES1 Antibody (7C9R6)
There are currently no reviews for this product. Be the first to review Carboxylesterase 1/CES1 Antibody (7C9R6) and earn rewards!
Have you used Carboxylesterase 1/CES1 Antibody (7C9R6)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...