Carboxylesterase 1/CES1 Antibody (7C9R6)

Novus Biologicals | Catalog # NBP3-15388

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7C9R6 expressed in HEK293
View all Carboxylesterase 1/CES1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Carboxylesterase 1/CES1 (P23141). MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carboxylesterase 1/CES1 Antibody (7C9R6)

Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]

Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]

Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388] - Western blot analysis of extracts of various cell lines, using Carboxylesterase 1/CES1 Rabbit mAb (NBP3-15388) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]

Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]

Immunocytochemistry/Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388] - Immunofluorescence analysis of HeLa cells using Carboxylesterase 1/CES1 Rabbit mAb (NBP3-15388) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]

Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388]

Western Blot: Carboxylesterase 1/CES1 Antibody (7C9R6) [NBP3-15388] - Western blot analysis of extracts of HepG2 cells, using Carboxylesterase 1/CES1 Rabbit mAb (NBP3-15388) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Carboxylesterase 1/CES1 Antibody (7C9R6)

Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] -

Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] - Confocal imaging of paraffin-embedded Mouse liver tissue using Carboxylesterase 1/CES1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Carboxylesterase 1/CES1 Antibody (7C9R6)

Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] -

Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody (7C9R6) [Carboxylesterase 1/CES1] - Confocal imaging of paraffin-embedded Rat liver tissue using Carboxylesterase 1/CES1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for Carboxylesterase 1/CES1 Antibody (7C9R6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Carboxylesterase 1/CES1

Carboxylesterase 1 hydrolyzes ester- and amide bonds of substrates ranging from small molecule esters such as phenylester to long-chain fatty acid esters and thioesters. It plays a major role in the pharmacokinetic behavior of many therapeutic agents containing an ester. Through de-esterification, it participates in the detoxification of drugs such as cocaine and heroin in serum and liver.

Alternate Names

ACAT, CES1, Egasyn, HMSE1, REH, SES1, TGH

Gene Symbol

CES1

Additional Carboxylesterase 1/CES1 Products

Product Documents for Carboxylesterase 1/CES1 Antibody (7C9R6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carboxylesterase 1/CES1 Antibody (7C9R6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carboxylesterase 1/CES1 Antibody (7C9R6)

There are currently no reviews for this product. Be the first to review Carboxylesterase 1/CES1 Antibody (7C9R6) and earn rewards!

Have you used Carboxylesterase 1/CES1 Antibody (7C9R6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies