Carboxylesterase 1/CES1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48854

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carboxylesterase 1/CES1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carboxylesterase 1/CES1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Analysis in human liver and cerebral cortex tissues using NBP2-48854 antibody. Corresponding CES1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Staining of human cerebral cortex, liver, prostate and upper gastrointestinal using Anti-CES1 antibody NBP2-48854 (A) shows similar protein distribution across tissues to independent antibody NBP1-85691 (B).
Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunocytochemistry/ Immunofluorescence: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunocytochemistry/Immunofluorescence: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Analysis of human cell line Hep G2 shows positivity in endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854]

Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP2-48854] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.

Applications for Carboxylesterase 1/CES1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carboxylesterase 1/CES1

Carboxylesterase 1 hydrolyzes ester- and amide bonds of substrates ranging from small molecule esters such as phenylester to long-chain fatty acid esters and thioesters. It plays a major role in the pharmacokinetic behavior of many therapeutic agents containing an ester. Through de-esterification, it participates in the detoxification of drugs such as cocaine and heroin in serum and liver.

Alternate Names

ACAT, CES1, Egasyn, HMSE1, REH, SES1, TGH

Gene Symbol

CES1

Additional Carboxylesterase 1/CES1 Products

Product Documents for Carboxylesterase 1/CES1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carboxylesterase 1/CES1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carboxylesterase 1/CES1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carboxylesterase 1/CES1 Antibody - BSA Free and earn rewards!

Have you used Carboxylesterase 1/CES1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies