CARD9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37975

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GSPKQPFAALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CARD9 Antibody - BSA Free

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Analysis in human spleen and cerebral cortex tissues. Corresponding CARD9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human spleen shows weak to moderate cytoplasmic positivity in a subset of leukocytes.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human tonsil shows moderate cytoplasmic positivity in a subset of leukocytes.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975]

Immunohistochemistry-Paraffin: CARD9 Antibody [NBP2-37975] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Applications for CARD9 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CARD9

Apoptosis is related to many diseases and development. Cell death signals are transduced by death domain (DD), death effector domain (DED), and caspase recruitment domain (CARD) containing molecules. CARD containing proteins include some caspases, Apaf-1, CARD4, IAPs, RICK, ARC, RAIDD, BCL-10, and ASC. A novel CARD-containing protein was recently identified and designated CARD9, which interacts with the CARD activation domain of BCL-10. CARD9 associates with BCL-10 and forms a complex within cells. CARD9 induces apoptosis and activates NF-kB. CARD9 is an upstream activator of BCL-10 and NF-kB signaling.

Long Name

Caspase Recruitment Domain Containing Protein 9

Alternate Names

CANDF2, caspase recruitment domain family, member 9, caspase recruitment domain-containing protein 9, hCARD9

Gene Symbol

CARD9

UniProt

Additional CARD9 Products

Product Documents for CARD9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CARD9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CARD9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CARD9 Antibody - BSA Free and earn rewards!

Have you used CARD9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies