Caspase-12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35067

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Caspase-12 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2).

Sequence:
FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Caspase-12 Antibody - BSA Free

Caspase-12 Antibody

Immunohistochemistry: Caspase-12 Antibody [NBP3-35067] -

Immunohistochemistry: Caspase-12 Antibody [NBP3-35067] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using Caspase-12 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Caspase-12 Antibody

Western Blot: Caspase-12 Antibody [NBP3-35067] -

Western Blot: Caspase-12 Antibody [NBP3-35067] - Western blot analysis of lysates from Mouse liver, using Caspase-12 Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Caspase-12 Antibody

Immunohistochemistry: Caspase-12 Antibody [NBP3-35067] -

Immunohistochemistry: Caspase-12 Antibody [NBP3-35067] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using Caspase-12 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Caspase-12 Antibody

Immunohistochemistry: Caspase-12 Antibody [NBP3-35067] -

Immunohistochemistry: Caspase-12 Antibody [NBP3-35067] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using Caspase-12 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Caspase-12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Caspase-12

Caspases are cysteine proteases that cleave C-terminal aspartic acid residues on their substrate molecules. This gene, CASP12, is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. In rodents, the homolog of this gene mediates apoptosis in response to endoplasmic reticulum stress. However, in humans this gene contains a polymorphism for the presence or absence of a premature stop codon. The majority of human individuals have the premature stop codon and produce a truncated non-functional protein. The read-through codon occurs primarily in individuals of African descent and carriers have endotoxin hypo-responsiveness and an increased susceptibility to severe sepsis. (provided by RefSeq)

Alternate Names

CASP12, Caspase12

Gene Symbol

CASP12

Additional Caspase-12 Products

Product Documents for Caspase-12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Caspase-12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Caspase-12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Caspase-12 Antibody - BSA Free and earn rewards!

Have you used Caspase-12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies