Caspase-3 Antibody (7T1W5) - Active, Pro

Novus Biologicals | Catalog # NBP3-15840

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7T1W5 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (P42574). SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Caspase-3 Antibody (7T1W5) - Active, Pro

Western Blot: Caspase-3 Antibody (7T1W5)Active, Pro [NBP3-15840]

Western Blot: Caspase-3 Antibody (7T1W5)Active, Pro [NBP3-15840]

Western Blot: Caspase-3 Antibody (1U1D9) - Active, Pro [NBP3-15840] - Western blot analysis of extracts of various cell lines, using Caspase-3 antibody (NBP3-15840) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Caspase-3 Antibody (7T1W5) - Active, Pro

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] -

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from Jurkat cells, using [KO Validated] active + pro Caspase-3 Rabbit mAb at 1:1000 dilution. Jurkat cells were treated by Etoposide (25 uM) at 37C for 5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Caspase-3 Antibody (7T1W5) - Active, Pro

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] -

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from NIH/3T3 cells using Caspase-3 Rabbit mAb at 1:1000 dilution incubated overnight at 4C. NIH/3T3 cells were treated by staurosporine(1 uM) for 3 hour.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 30 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Caspase-3 Antibody (7T1W5) - Active, Pro

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] -

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from L929 cells, using [KO Validated] active + pro Caspase-3 Rabbit mAb at 1:1000 dilution. L929 cells were treated by staurosporine(1 uM) for 3 hour.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Caspase-3 Antibody (7T1W5) - Active, Pro

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] -

Western Blot: Caspase-3 Antibody (7T1W5) - Active, Pro [Caspase-3] - Western blot analysis of lysates from wild type (WT) and Caspase-3 knockout (KO) 293T cells using [KO Validated] Caspase-3 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for Caspase-3 Antibody (7T1W5) - Active, Pro

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Caspase-3

CPP32 encodes a member of the cysteine-aspartic acid protease (caspase) family that plays a key role in apoptosis. Caspase 3 (also known as CPP32, Apopain, Yama, and PARP cleavage protease) is the most extensively studied apoptotic protein among caspase family members (1-2). Caspase 3 is synthesized as an inactive proenzyme that is processed in cells undergoing apoptosis by self-proteolysis and/or cleavage by other upstream proteases (e.g. Caspases 8, 9 and 10). Alternative splicing of CPP32 results in two transcript variants which encode the same protein. The processed form of Caspase 3 consists of large (theoretical molecular weight 17kD) and small (theoretical molecular weight 12kD) subunits which associate to form an active enzyme. Caspase 3 is cleaved at Asp28/Ser29 and Asp175/Ser176. The active Caspase 3 proteolytically cleaves and activates other caspases (e.g. Caspases 6, 7 and 9), as well as relevant targets in the cells (e.g. PARP and DFF). Variations in levels of Caspase 3 have been reported in cells of short-lived nature and those with a longer life cycle. Caspase 3 is the predominant caspase involved in the cleavage of amyloid beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease (3).

References

1.Mu, N., Lei, Y., Wang, Y., Wang, Y., Duan, Q., Ma, G.,... Su, L. (2019). Inhibition of SIRT1/2 upregulates HSPA5 acetylation and induces pro-survival autophagy via ATF4-DDIT4-mTORC1 axis in human lung cancer cells. Apoptosis, 24(9-10), 798-811. doi:10.1007/s10495-019-01559-3

2.Sun, C. M., Enkhjargal, B., Reis, C., Zhou, K. R., Xie, Z. Y., Wu, L. Y.,... Zhang, J. H. (2019). Osteopontin attenuates early brain injury through regulating autophagy-apoptosis interaction after subarachnoid hemorrhage in rats. CNS Neurosci Ther, 25(10), 1162-1172. doi:10.1111/cns.13199

3.Louneva, N., Cohen, J. W., Han, L. Y., Talbot, K., Wilson, R. S., Bennett, D. A.,... Arnold, S. E. (2008). Caspase-3 is enriched in postsynaptic densities and increased in Alzheimer's disease. Am J Pathol, 173(5), 1488-1495. doi:10.2353/ajpath.2008.080434

Alternate Names

Apopain, CASP3, Caspase3, CPP32, LICE-1, YAMA

Gene Symbol

CASP3

Additional Caspase-3 Products

Product Documents for Caspase-3 Antibody (7T1W5) - Active, Pro

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Caspase-3 Antibody (7T1W5) - Active, Pro

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Caspase-3 Antibody (7T1W5) - Active, Pro

There are currently no reviews for this product. Be the first to review Caspase-3 Antibody (7T1W5) - Active, Pro and earn rewards!

Have you used Caspase-3 Antibody (7T1W5) - Active, Pro?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies