Caspase-6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87684

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Caspase-6 Antibody - BSA Free

Western Blot: Caspase-6 Antibody [NBP1-87684]

Western Blot: Caspase-6 Antibody [NBP1-87684]

Western Blot: Caspase-6 Antibody [NBP1-87684] - Analysis using Anti-CASP6 antibody NBP1-87684 (A) shows similar pattern to independent antibody NBP1-87683 (B).
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining in human small intestine and skeletal muscle tissues using anti-CASP6 antibody. Corresponding CASP6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684]

Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human small intestine shows high expression.

Applications for Caspase-6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Caspase-6

Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the initiation and execution of apoptosis. Caspase-6 is a major apoptotic executioner (1,2). It exists as a pro-domain protein and is cleaved by caspase-3 into two active subunits, an 18 kDa and a 10 kDa subunit (3). Caspase-6 cleaves among many different intracellular proteins, nuclear lamins. Lamins play a significant role in maintaining the integrity of the cell membrane, and their cleavage results in subsequent cellular breakdown and death (4).

Alternate Names

CASP6, Caspase6, Mch2

Gene Symbol

CASP6

Additional Caspase-6 Products

Product Documents for Caspase-6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Caspase-6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Caspase-6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Caspase-6 Antibody - BSA Free and earn rewards!

Have you used Caspase-6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Apoptosis Signaling Pathway Apoptosis Signaling Pathway Thumbnail