Catalase Antibody (7D2Y4)

Novus Biologicals | Catalog # NBP3-15357

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7D2Y4 expressed in HEK293
View all Catalase Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Catalase (P04040). MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Catalase Antibody (7D2Y4)

Western Blot: Catalase Antibody (7D2Y4) [NBP3-15357]

Western Blot: Catalase Antibody (7D2Y4) [NBP3-15357]

Western Blot: Catalase Antibody (7D2Y4) [NBP3-15357] - Western blot analysis of extracts of various cell lines, using Catalase Rabbit mAb (NBP3-15357) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Catalase Antibody (7D2Y4) [NBP3-15357]

Immunohistochemistry-Paraffin: Catalase Antibody (7D2Y4) [NBP3-15357]

Immunohistochemistry-Paraffin: Catalase Antibody (7D2Y4) [NBP3-15357] - Immunohistochemistry of paraffin-embedded Mouse kidney using Catalase antibody (NBP3-15357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Catalase Antibody (7D2Y4)

Western Blot: Catalase Antibody (7D2Y4) [Catalase] -

Western Blot: Catalase Antibody (7D2Y4) [Catalase] - Western blot analysis of lysates from Hep G2 cells using Catalase Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Catalase Antibody (7D2Y4)

Immunohistochemistry: Catalase Antibody (7D2Y4) [Catalase] -

Immunohistochemistry: Catalase Antibody (7D2Y4) [Catalase] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Catalase Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Catalase Antibody (7D2Y4)

Immunohistochemistry: Catalase Antibody (7D2Y4) [Catalase] -

Immunohistochemistry: Catalase Antibody (7D2Y4) [Catalase] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Catalase Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Catalase Antibody (7D2Y4)

Immunohistochemistry: Catalase Antibody (7D2Y4) [Catalase] -

Immunohistochemistry: Catalase Antibody (7D2Y4) [Catalase] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Catalase Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Catalase Antibody (7D2Y4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:500 - 1:5000

Immunohistochemistry-Paraffin

1:500 - 1:5000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Catalase

Human catalase is an heme-containing peroxisomal enzyme that breaks down hydrogen peroxide to water and oxygen; it is implicated in ethanol metabolism, inflammation, apoptosis, aging and cancer. The 1.5A resolution human enzyme structure, both with and without bound NADPH, establishes the conserved features of mammalian catalase fold and assembly, implicates Tyr370 as the tyrosine radical, suggests the structural basis for redox-sensitive binding of cognate mRNA via the catalase NADPH binding site, and identifies an unexpectedly substantial number of water-mediated domain contacts (1). Because catalase has a low affinity for H2O2, it has been suggested that glutathione peroxidase clears most H2O2 within the erthrocyte and that catalase is of little import. It has been hypothesized that erythrocyte catalase might function to protect heterologous somatic cells against challenge by high levels of exogenous H2O2 (e.g., in areas of inflamation) (2).

Alternate Names

Cas1, CAT, Cs-1

Gene Symbol

CAT

Additional Catalase Products

Product Documents for Catalase Antibody (7D2Y4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Catalase Antibody (7D2Y4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Oxidative Stress

Customer Reviews for Catalase Antibody (7D2Y4)

There are currently no reviews for this product. Be the first to review Catalase Antibody (7D2Y4) and earn rewards!

Have you used Catalase Antibody (7D2Y4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies