Caveolin-1 Antibody (10Y5L2)

Novus Biologicals | Catalog # NBP3-15615

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10Y5L2 expressed in HEK293
View all Caveolin-1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2). MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Caveolin-1 Antibody (10Y5L2)

Western Blot: Caveolin-1 Antibody (10Y5L2) [NBP3-15615]

Western Blot: Caveolin-1 Antibody (10Y5L2) [NBP3-15615]

Western Blot: Caveolin-1 Antibody (9I9J8) [NBP3-15615] - Western blot analysis of extracts of HeLa cells, using Caveolin-1antibody (NBP3-15615) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Caveolin-1 Antibody (10Y5L2)

Immunohistochemistry-Paraffin: Caveolin-1 Antibody (9I9J8) [NBP3-15615] -

Immunohistochemistry-Paraffin: Caveolin-1 Antibody (9I9J8) [NBP3-15615] - Human colon using Caveolin-1 Rabbit mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Caveolin-1 Antibody (10Y5L2)

Immunohistochemistry-Paraffin: Caveolin-1 Antibody (9I9J8) [NBP3-15615] -

Immunohistochemistry-Paraffin: Caveolin-1 Antibody (9I9J8) [NBP3-15615] -Human lung using Caveolin-1 Rabbit mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Caveolin-1 Antibody (10Y5L2)

Western Blot: Caveolin-1 Antibody (10Y5L2) [Caveolin-1] -

Western Blot: Caveolin-1 Antibody (10Y5L2) [Caveolin-1] - Western blot analysis of various lysates, using Caveolin-1 Rabbit mAb at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for Caveolin-1 Antibody (10Y5L2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:5000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Caveolin-1

Caveolae are specialized domains of the plasma membrane that are implicated in the sequestration of a variety of lipid and protein molecules. It has been suggested that these important cellular organelles have a pivotal role in such diverse biochemical processes as lipid metabolism, growth regulation, signal transduction, and apoptosis. Caveolin interacts with and regulates heterotrimeric G-proteins. Currently, there are three members of the caveolin multigene family which are known to encode 21-24 kDa integral membrane proteins that comprise the major structural component of the caveolar membrane in vivo. Caveolin-2 protein is abundantly expressed in fibroblasts and differentiated adipocytes, smooth and skeletal muscle, and endothelial cells. The expression of caveolin-1 is similar to that of caveolin-2 while caveolin-3 expression appears to be limited to muscle tissue types.

Alternate Names

CAV1, Caveolin1, MSTP085, VIP21

Gene Symbol

CAV1

Additional Caveolin-1 Products

Product Documents for Caveolin-1 Antibody (10Y5L2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Caveolin-1 Antibody (10Y5L2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Caveolin-1 Antibody (10Y5L2)

There are currently no reviews for this product. Be the first to review Caveolin-1 Antibody (10Y5L2) and earn rewards!

Have you used Caveolin-1 Antibody (10Y5L2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies