Caveolin-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33431

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Caveolin-2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Caveolin-2 Antibody - BSA Free

Western Blot: Caveolin-2 Antibody [NBP2-33431]

Western Blot: Caveolin-2 Antibody [NBP2-33431]

Western Blot: Caveolin-2 Antibody [NBP2-33431] - Analysis in human cell lines A-431 and MCF-7 using anti-CAV2 antibody. Corresponding CAV2 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
Immunocytochemistry/ Immunofluorescence: Caveolin-2 Antibody [NBP2-33431]

Immunocytochemistry/ Immunofluorescence: Caveolin-2 Antibody [NBP2-33431]

Immunocytochemistry/Immunofluorescence: Caveolin-2 Antibody [NBP2-33431] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431]

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431]

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431] - Staining in human lung and pancreas tissues using anti-CAV2 antibody. Corresponding CAV2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431]

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431]

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431] - Staining of human lung shows strong cytoplasmic and membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431]

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431]

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP2-33431] - Staining of human pancreas shows low expression as expected.

Applications for Caveolin-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Caveolin-2

Caveolae are cholesterol/sphingolipid-rich microdomains of the plasma membrane that have been implicated in signal transduction and vesicular trafficking. Caveolins are a family of caveolae-associated integral membrane proteins (1). Caveolin, a 21- to 24-kDa integral membrane protein, is a principal component of caveolae membranes. Caveolin interacts directly with heterotrimeric guanine nucleotide binding proteins (G proteins) and can functionally regulate their activity. Caveolins 1 and 2 are similar in most respects, however, caveolin-1 and caveolin-2 differ in their functional interactions with heterotrimeric G proteins, possibly explaining why caveolin-1 and -2 are coexpressed within a single cell (2). Caveolin-2 is up-regulated in response to the mechanical injury of differentiated PC12 cells; up-regulation of caveolin-2 under these conditions is strictly dependent on continued treatment with NGF. Robust expression of caveolin-1 and -2 is also observed along the entire cell surface of DRG neurons, including high levels on growth cones. These findings demonstrate that neuronal cells express caveolins (1).

Alternate Names

CAV2, Caveolin2

Gene Symbol

CAV2

UniProt

P51636

Additional Caveolin-2 Products

Product Documents for Caveolin-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Caveolin-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Citations for Caveolin-2 Antibody - BSA Free

Customer Reviews for Caveolin-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Caveolin-2 Antibody - BSA Free and earn rewards!

Have you used Caveolin-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies