CBLL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83589

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CBLL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human cerebellum, liver, placenta and testis using Anti-CBLL1 antibody NBP1-83589 (A) shows similar protein distribution across tissues to independent antibody NBP1-83588 (B).
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human cerebellum shows strong nuclear positivity in all layers.
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human liver shows very weak positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
CBLL1 Antibody - BSA Free Western Blot: CBLL1 Antibody - BSA Free [NBP1-83589]

Western Blot: CBLL1 Antibody - BSA Free [NBP1-83589]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
CBLL1 Antibody - BSA Free

Western Blot: CBLL1 Antibody - BSA Free [NBP1-83589] -

METTL3, METTL14, WTAP and CBLL1 expression in non-malignant and prostate cancer cell lines; mRNA expression analysed by qRT-PCR relative to beta -actin(A–D) and protein expression analysed using western blot (E). METTL3 protein expression as previously reported in Haigh et al. (2022). *p ≤.05, **p ≤.005, ***p ≤.001, ****p ≤.0001 by unpaired t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36733939), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CBLL1 Antibody - BSA Free

Western Blot: CBLL1 Antibody - BSA Free [NBP1-83589] -

METTL3, METTL14, WTAP and CBLL1 expression in PCa cell lines LNCaP (n = 9) (A), LNCaP:C4-2 (n = 9) (B), 22Rv1 (n = 6) (C) with vehicle or R1881 (1 nM) treatment for 72 h; mRNA expression analysed by qRT-PCR relative to beta -actin and protein expression analysed using western blot (D). ns, not significant; **p ≤.005, ***p ≤.001, ****p ≤.0001 by unpaired t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36733939), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CBLL1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CBLL1

Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex.[supplied by OMIM]

Alternate Names

Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1, Casitas B-lineage lymphoma-transforming sequence-like protein 1, c-Cbl-like protein 1, E3 ubiquitin-protein ligase Hakai, EC 6.3.2, EC 6.3.2.-, E-cadherin binding protein E7, HAKAIRNF188FLJ23109, MGC163401, MGC163403, RING finger protein 188

Gene Symbol

CBLL1

Additional CBLL1 Products

Product Documents for CBLL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CBLL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CBLL1 Antibody - BSA Free

Customer Reviews for CBLL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBLL1 Antibody - BSA Free and earn rewards!

Have you used CBLL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...