CBLL1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83589
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CBLL1 Antibody - BSA Free
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human cerebellum, liver, placenta and testis using Anti-CBLL1 antibody NBP1-83589 (A) shows similar protein distribution across tissues to independent antibody NBP1-83588 (B).Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human cerebellum shows strong nuclear positivity in all layers.Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human liver shows very weak positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589]
Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.Western Blot: CBLL1 Antibody - BSA Free [NBP1-83589]
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Western Blot: CBLL1 Antibody - BSA Free [NBP1-83589] -
METTL3, METTL14, WTAP and CBLL1 expression in non-malignant and prostate cancer cell lines; mRNA expression analysed by qRT-PCR relative to beta -actin(A–D) and protein expression analysed using western blot (E). METTL3 protein expression as previously reported in Haigh et al. (2022). *p ≤.05, **p ≤.005, ***p ≤.001, ****p ≤.0001 by unpaired t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36733939), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CBLL1 Antibody - BSA Free [NBP1-83589] -
METTL3, METTL14, WTAP and CBLL1 expression in PCa cell lines LNCaP (n = 9) (A), LNCaP:C4-2 (n = 9) (B), 22Rv1 (n = 6) (C) with vehicle or R1881 (1 nM) treatment for 72 h; mRNA expression analysed by qRT-PCR relative to beta -actin and protein expression analysed using western blot (D). ns, not significant; **p ≤.005, ***p ≤.001, ****p ≤.0001 by unpaired t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36733939), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for CBLL1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CBLL1
Alternate Names
Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1, Casitas B-lineage lymphoma-transforming sequence-like protein 1, c-Cbl-like protein 1, E3 ubiquitin-protein ligase Hakai, EC 6.3.2, EC 6.3.2.-, E-cadherin binding protein E7, HAKAIRNF188FLJ23109, MGC163401, MGC163403, RING finger protein 188
Gene Symbol
CBLL1
Additional CBLL1 Products
Product Documents for CBLL1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CBLL1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CBLL1 Antibody - BSA Free
Customer Reviews for CBLL1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CBLL1 Antibody - BSA Free and earn rewards!
Have you used CBLL1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...