CBR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87065

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CBR3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CBR3 Antibody [NBP1-87065]

Immunohistochemistry-Paraffin: CBR3 Antibody [NBP1-87065]

Immunohistochemistry-Paraffin: CBR3 Antibody [NBP1-87065] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in lymphocytes outside reaction center cells.
CBR3 Antibody - BSA Free Immunohistochemistry-Paraffin: CBR3 Antibody - BSA Free [NBP1-87065]

Immunohistochemistry-Paraffin: CBR3 Antibody - BSA Free [NBP1-87065]

Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Western Blot: CBR3 Antibody [NBP1-87065]

Western Blot: CBR3 Antibody [NBP1-87065]

Western Blot: CBR3 Antibody [NBP1-87065] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
CBR3 Antibody - BSA Free Western Blot: CBR3 Antibody - BSA Free [NBP1-87065]

Western Blot: CBR3 Antibody - BSA Free [NBP1-87065]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for CBR3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CBR3

Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three exons spanning 11.2 kilobases and is closely linked to another carbonyl reductase gene - CBR1. [provided by RefSeq]

Alternate Names

carbonyl reductase (NADPH) 3, carbonyl reductase (NADPH) 3, EC 1.1.1.18410EC 1.1.1, carbonyl reductase [NADPH] 3, carbonyl reductase 3, EC 1.1.1.184, hCBR3, NADPH-dependent carbonyl reductase 3, SDR21C2, short chain dehydrogenase/reductase family 21C, member 2

Gene Symbol

CBR3

Additional CBR3 Products

Product Documents for CBR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CBR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CBR3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBR3 Antibody - BSA Free and earn rewards!

Have you used CBR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...